Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.07
PubTator Score 0.07

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
psoriasis 6685 4.0e-16
pituitary cancer 1972 3.4e-03


Accession Q6IC83 A4QPH5
Symbols dJ90G24.6


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

AA Sequence

EDLMTPEMAKERYEDYLCWVKMARSRLNEPISSQVLGLLRL                                 211 - 251

Text Mined References (3)

PMID Year Title
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.