Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.07
PubTator Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 4.0e-16
pituitary cancer 1972 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

AA Sequence

MGSKLTCCLGPSGGLNCDCCRPDVGPCHECEIPETVAATAPASTTAKPAKLDLKAKKAQLMQYLSLPKTP      1 - 70
KMLKMSKGLDARSKRWLKIIWRRHGIWPLENIGPTEDVQASAHGGVEENMTSDIEIPEAKHDHRPTEDVQ     71 - 140
VSAHGGVEENITSDIEISEAKHDHHLVEDLSESLSVCLEDFMTSDLSESLSVSLEDFMTSGLSESLSVSL    141 - 210
EDLMTPEMAKERYEDYLCWVKMARSRLNEPISSQVLGLLRL                                 211 - 251
//

Text Mined References (3)

PMID Year Title