Property Summary

NCBI Gene PubMed Count 7
PubMed Score 123.09
PubTator Score 9.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3163 9.8e-07
osteosarcoma 7933 4.6e-06
glioblastoma 5572 1.9e-05
lung cancer 4473 3.6e-03
colon cancer 1475 3.5e-02
Disease Target Count Z-score Confidence
Cancer 2346 4.254 2.1

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.900 9.8e-07
osteosarcoma -1.462 4.6e-06
glioblastoma -1.200 1.9e-05
colon cancer 1.300 3.5e-02
lung cancer 1.300 3.6e-03

Gene RIF (3)

PMID Text
25404273 Studies indicate that BH3-only protein (C22orf29 protein) plays an important role in activation and communication in apoptosis pathways.
24673301 Members of the subfamily of BH3-only proteins function as proapoptotic triggers, and mimetics of these proteins are already in clinical trials in other cancers.
23055042 Bop may be a novel BH3-only factor that can engage with the regulatory network of Bcl-2 family members to process intrinsic apoptotic signaling

AA Sequence

MPRGRCRQQGPRIPIWAAANYANAHPWQQMDKASPGVAYTPLVDPWIERPCCGDTVCVRTTMEQKSTASG      1 - 70
TCGGKPAERGPLAGHMPSSRPHRVDFCWVPGSDPGTFDGSPWLLDRFLAQLGDYMSFHFEHYQDNISRVC     71 - 140
EILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQDPNSFAEYHAVVTCPLPLASSQLPVAPQLP    141 - 210
VVRQYLARFLEGLALDMGTAPRSLPAAMATPAVSGSNSVSRSALFEQQLTKESTPGPKEPPVLPSSTCSS    211 - 280
KPGPVEPASSQPEEAAPTPVPRLSESANPPAQRPDPAHPGGPKPQKTEEEVLETEGDQEVSLGTPQEVVE    281 - 350
APETPGEPPLSPGF                                                            351 - 364
//

Text Mined References (11)

PMID Year Title
25404273 2014 [Effect and significance of BH3-only protein in targeted therapy of? non-small cell lung cancer].
24673301 2014 BH3-only proteins: possible proapoptotic triggers for melanoma therapy.
23055042 2012 Human Bop is a novel BH3-only member of the Bcl-2 protein family.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.