Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ependymoma 4679 2.6e-07

Expression

  Differential Expression (1)

Disease log2 FC p
ependymoma 1.500 2.6e-07

 Compartment GO Term (1)

AA Sequence

MASQKQMEVVTKGTGFRRRPKTITYTPGTCELLRVMMKESKLTNIQQRHIMDIMKRGDALPLQCSPTSSQ      1 - 70
RVLPSKQIASPIYLPPILAARPHLRPANMCQANGAYSREQFKPQATRDLEKEKQRLQNIFATGKDMEERK     71 - 140
RKAPPARQKAPAPELDRFEELVKEIQERKEFLADMEALGQGKQYRGIILAEISQKLREMEDIDHRRSEEL    141 - 210
RKGLATT                                                                   211 - 217
//

Text Mined References (9)

PMID Year Title