Property Summary

NCBI Gene PubMed Count 9
PubMed Score 45.24
PubTator Score 14.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 7.6e-04
gastric cancer 1.400 1.4e-03
glioblastoma 1.300 4.0e-04
hepatocellular carcinoma 1.400 2.0e-05
juvenile dermatomyositis 1.801 2.1e-15
lung carcinoma -1.600 2.3e-15
malignant mesothelioma 1.100 5.9e-05
medulloblastoma 1.200 7.5e-05
medulloblastoma, large-cell 1.100 3.5e-04
Multiple myeloma 1.259 2.9e-02
oligodendroglioma -1.200 1.8e-04
osteosarcoma 1.051 2.3e-02
ovarian cancer 1.200 2.1e-05
primitive neuroectodermal tumor 1.200 1.4e-03
psoriasis 1.100 6.7e-06

Synonym

Accession Q9NYK6 B2RB30 Q96BK9 Q9H8C6
Symbols EURL
YG81
CSSG1
C21orf14
C21orf38

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MNEEEQFVNIDLNDDNICSVCKLGTDKETLSFCHICFELNIEGVPKSDLLHTKSLRGHKDCFEKYHLIAN      1 - 70
QGCPRSKLSKSTYEEVKTILSKKINWIVQYAQNKDLDSDSECSKNPQHHLFNFRHKPEEKLLPQFDSQVP     71 - 140
KYSAKWIDGSAGGISNCTQRILEQRENTDFGLSMLQDSGATLCRNSVLWPHSHNQAQKKEETISSPEANV    141 - 210
QTQHPHYSREELNSMTLGEVEQLNAKLLQQIQEVFEELTHQVQEKDSLASQLHVRHVAIEQLLKNCSKLP    211 - 280
CLQVGRTGMKSHLPINN                                                         281 - 297
//

Text Mined References (11)

PMID Year Title