Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.54
PubTator Score 0.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.400 5.6e-05
intraductal papillary-mucinous carcinoma... -1.100 7.2e-03
osteosarcoma -3.588 5.3e-08
posterior fossa group B ependymoma 1.200 7.0e-06

 Compartment GO Term (2)

AA Sequence

MARSRLPATSLRKPWKLDRQKLPSPDSGHSLLCGWSPGGKARPAGNTGAWAPAEQFFPASNRTREGGGLW      1 - 70
PPLPLQSSPAAPTMLDSSAAEQVTRLTLKLLGQKLEQERQNVEGGPEGLHLEPGNEDRPDDALQTALKRR     71 - 140
RDLLQRLREQHLLDELSRAQAWSGPSRGALGSALPPELPPTGILPTASPSPLAPDPPRIILPTVPQPPAT    141 - 210
IIQQLPQQPLIAQIPPPQAFPTQRSGSIKEDMVELLLLQNAQVHQLVLQNWMLKALPPALQDPPHVPPRV    211 - 280
PRAARPRLPAVHHHHHHHHAVWPPGAATVLQPAPSLWTPGPP                                281 - 322
//

Text Mined References (7)

PMID Year Title