Property Summary

NCBI Gene PubMed Count 7
PubMed Score 42.57
PubTator Score 9.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
nasopharyngeal carcinoma 1024 1.8e-07
lung carcinoma 2755 2.6e-05
non-small cell lung cancer 2799 5.0e-04
lung adenocarcinoma 2627 2.0e-03
Endometriosis 521 5.0e-02
Disease Target Count Z-score Confidence
Asthma 370 0.0 1.1
Disease Target Count Z-score Confidence
lung cancer 4607 4.63 2.3

Expression

  Differential Expression (5)

Disease log2 FC p
Endometriosis -1.553 5.0e-02
lung adenocarcinoma -1.300 2.0e-03
lung carcinoma -2.200 2.6e-05
nasopharyngeal carcinoma -4.100 1.8e-07
non-small cell lung cancer -1.498 5.0e-04

Synonym

Accession Q9H1P6
Symbols LLC1
bA196N14.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

Gene RIF (2)

AA Sequence

MAQKPLSTAAAERMNLVGQDEIWKYRLKAESEARQNWPQNWGFLTTPFEELIKCEEDLPTPKPKIELPER      1 - 70
FRIRPVTPVEKYIKVFPSPPVPQTTQGFIGWRSAVPGLNKCLELDDAIRSCKGAFARELCWPKQGVH        71 - 137
//

Text Mined References (7)

PMID Year Title