Property Summary

NCBI Gene PubMed Count 5
PubMed Score 47.91
PubTator Score 3.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
chronic rhinosinusitis -1.680 2.9e-02
ependymoma 1.100 2.8e-02
lung adenocarcinoma -1.300 2.2e-07
nasopharyngeal carcinoma -1.700 3.8e-07
non-small cell lung carcinoma -1.200 1.2e-08

AA Sequence

MSSAWKTPRGSDAMPEIMVKIIGSKHFQYLVEKPKIKENDSLKTETQTMHQKPMTDNARQMSRDTPVPIN      1 - 70
FTDQQTTDNPDDVKEKKHPENNQKSENNQKLLTGANSSRFLDGNIPSQANVHCSSVPTGDQSLSYVHGIP     71 - 140
RRKLRDWSLEQMVRGSSDQPEDIGQSPSGTTNEDAFLLALVRRELKSRPLSSNLLEKLQKELKILDPISS    141 - 210
GFLLQSQLSRLFLKHEVPLQLPTVKILCQRFSKRGSPEMVNYEKLLWFLNSAASDYPQQNKAAADLRKTE    211 - 280
SHGTHSQSTPPQHSSSQPEVNRSLLEILKMALRTTNGRLNIDNLNLSFRKEDRSFSGCLPLPKVRAICGK    281 - 350
HGLYLTLSLLETLLNHQDLGYQNEIKWQNFVEMLTRASSDLLSDLPTGKNEKKAPAPPMEPEVPEMSQSK    351 - 420
TEHMKTPEEELQPESSPAETSACKDPLKPLKIRPVSQPFVNPAVKNKAEECETWIDRFRKLENALYLCDL    421 - 490
SNTGVLEKERARRLIHNYNLIYNLSLSPQKIDQALRRFRSGENMLLEPALRYLKEL                  491 - 546
//

Text Mined References (8)

PMID Year Title