Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia -1.500 3.0e-02
colon cancer -1.300 1.7e-02
gastric carcinoma 1.800 8.7e-03
group 4 medulloblastoma -1.100 1.9e-04
interstitial cystitis 1.400 2.0e-03
intraductal papillary-mucinous adenoma (... -1.300 2.7e-03
intraductal papillary-mucinous carcinoma... -1.600 2.9e-03
lung adenocarcinoma -1.100 1.1e-05
malignant mesothelioma 1.300 2.2e-06
ovarian cancer 1.100 9.9e-03
pituitary cancer 1.400 1.4e-03
subependymal giant cell astrocytoma 2.153 2.5e-03
ulcerative colitis 1.200 6.3e-05

Synonym

Accession Q8WWF1 Q9H5P3
Symbols

Gene

  Ortholog (2)

AA Sequence

MDVLFVAIFAVPLILGQEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDI      1 - 70
TEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM              71 - 131
//

Text Mined References (9)

PMID Year Title