Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.800 6.8e-03
ependymoma -1.700 1.8e-02
oligodendroglioma -1.500 1.5e-02
glioblastoma -2.400 1.2e-06
atypical teratoid / rhabdoid tumor -2.900 2.9e-09
medulloblastoma -1.500 9.2e-05
medulloblastoma, large-cell -2.300 3.3e-07
primitive neuroectodermal tumor -1.200 3.1e-03
juvenile dermatomyositis 1.037 1.3e-08
primary pancreatic ductal adenocarcinoma 1.183 2.4e-03
adult high grade glioma -2.000 3.6e-05
pilocytic astrocytoma -1.800 1.9e-06
subependymal giant cell astrocytoma -1.515 1.2e-02
Pick disease -1.300 1.6e-04
ovarian cancer 1.500 1.2e-03

Synonym

Accession Q8N6N3 B3KX89 Q8TDK5 Q8TDK6
Symbols gm117

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAEEKDPLSYFAAYGSSSSGSSDEEDNIEPEETSRRTPDPAKSAGGCRNKAEKRLPGPDELFRSVTRPA      1 - 70
FLYNPLNKQIDWERHVVKAPEEPPKEFKIWKSNYVPPPETYTTEKKPPPPELDMAIKWSNIYEDNGDDAP     71 - 140
QNAKKARLLPEGEETLESDDEKDEHTSKKRKVEPGEPAKKKK                                141 - 182
//

Text Mined References (16)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11891061 2002 Identification of six novel genes by experimental validation of GeneMachine predicted genes.