Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.000 3.6e-05
astrocytic glioma -1.800 6.8e-03
Astrocytoma, Pilocytic -1.700 2.7e-06
atypical teratoid / rhabdoid tumor -2.900 2.9e-09
ependymoma -1.700 1.8e-02
glioblastoma -1.500 7.9e-06
juvenile dermatomyositis 1.037 1.3e-08
medulloblastoma -1.500 9.2e-05
medulloblastoma, large-cell -1.200 8.6e-05
oligodendroglioma -1.500 1.5e-02
ovarian cancer -1.200 9.0e-06
Pick disease -1.300 1.6e-04
primary pancreatic ductal adenocarcinoma 1.183 2.4e-03
primitive neuroectodermal tumor -1.200 3.1e-03
subependymal giant cell astrocytoma -1.515 1.2e-02

Synonym

Accession Q8N6N3 B3KX89 Q8TDK5 Q8TDK6
Symbols gm117

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAAEEKDPLSYFAAYGSSSSGSSDEEDNIEPEETSRRTPDPAKSAGGCRNKAEKRLPGPDELFRSVTRPA      1 - 70
FLYNPLNKQIDWERHVVKAPEEPPKEFKIWKSNYVPPPETYTTEKKPPPPELDMAIKWSNIYEDNGDDAP     71 - 140
QNAKKARLLPEGEETLESDDEKDEHTSKKRKVEPGEPAKKKK                                141 - 182
//

Text Mined References (16)

PMID Year Title