Property Summary

NCBI Gene PubMed Count 6
PubMed Score 553.35
PubTator Score 45.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
gastric carcinoma -1.700 1.1e-02
non primary Sjogren syndrome sicca 1.200 1.3e-02
ovarian cancer 1.400 6.9e-11
ulcerative colitis -1.900 1.3e-05

AA Sequence

MNETNKTLVGPSELPTASAVAPGPGTGARAWPVLVGFVLGAVVLSLLIALAAKCHLCRRYHASYRHRPLP      1 - 70
ETGRGGRPQVAEDEDDDGFIEDNYIQPGTGELGTEGSRDHFSL                                71 - 113
//

Text Mined References (6)

PMID Year Title