Property Summary

NCBI Gene PubMed Count 5
PubMed Score 513.76
PubTator Score 45.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 6.9e-11
ulcerative colitis 2087 1.3e-05
gastric carcinoma 832 1.1e-02
non primary Sjogren syndrome sicca 840 1.3e-02
Disease Target Count Z-score Confidence
Prostate calculus 3 4.395 2.2

Expression

  Differential Expression (4)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 1.3e-02
gastric carcinoma -1.700 1.1e-02
ulcerative colitis -1.900 1.3e-05
ovarian cancer 1.400 6.9e-11

AA Sequence

MNETNKTLVGPSELPTASAVAPGPGTGARAWPVLVGFVLGAVVLSLLIALAAKCHLCRRYHASYRHRPLP      1 - 70
ETGRGGRPQVAEDEDDDGFIEDNYIQPGTGELGTEGSRDHFSL                                71 - 113
//

Text Mined References (5)

PMID Year Title
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.