Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
acute quadriplegic myopathy -1.101 1.1e-07
adrenocortical carcinoma -1.625 6.0e-04
adult high grade glioma -2.100 7.6e-07
atypical teratoid / rhabdoid tumor -3.100 4.8e-08
Breast cancer -1.100 8.8e-04
colon cancer -1.400 3.8e-03
cutaneous lupus erythematosus -2.500 1.8e-03
ependymoma -1.700 2.9e-02
glioblastoma -1.600 3.7e-06
group 4 medulloblastoma -2.100 5.4e-08
intraductal papillary-mucinous neoplasm ... 1.700 1.4e-02
invasive ductal carcinoma -1.174 1.5e-02
lung adenocarcinoma -1.100 1.5e-13
lung cancer -2.000 1.6e-05
lung carcinoma -1.500 6.8e-15
malignant mesothelioma -1.500 1.8e-07
medulloblastoma, large-cell -2.900 2.2e-05
non-small cell lung cancer -1.526 6.9e-25
ovarian cancer -1.300 2.9e-03
pancreatic cancer 1.200 1.7e-03
primary pancreatic ductal adenocarcinoma 1.439 9.7e-04
primitive neuroectodermal tumor -1.900 4.1e-04
psoriasis -1.200 2.5e-07
subependymal giant cell astrocytoma -1.809 1.7e-02
type I diabetes mellitus -1.002 1.4e-02
urothelial carcinoma -1.400 3.5e-02

 Compartment GO Term (2)

AA Sequence

MGCASAKHVATVQNEEEAQKGKNYQNGDVFGDEYRIKPVEEVKYMKNGAEEEQKIAARNQENLEKSASSN      1 - 70
VRLKTNKEVPGLVHQPRANMHISESQQEFFRMLDEKIEKGRDYCSEEEDIT                        71 - 121
//

Text Mined References (13)

PMID Year Title