Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
nasopharyngeal carcinoma 1058 4.0e-09
non-small cell lung carcinoma 317 3.6e-07
ovarian cancer 8520 2.5e-06
lung adenocarcinoma 2716 2.0e-04
ependymoma 4679 3.3e-02
Disease Target Count Z-score Confidence
Malignant ependymoma 5 5.039 2.5

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 2.300 3.3e-02
lung adenocarcinoma -1.100 2.0e-04
nasopharyngeal carcinoma -1.600 4.0e-09
non-small cell lung carcinoma -1.200 3.6e-07
ovarian cancer 1.200 2.5e-06

AA Sequence

MPPTRDPFQQPTLDNDDSYLGELRASKKLPYKNPTHLAQQQEPWSRLNSTPTITSMRRDAYYFDPEIPKD      1 - 70
DLDFRLAALYNHHTGTFKNKSEILLNQKTTQDTYRTKIQFPGEFLTPPTPPITFLANIRHWINPKKESIH     71 - 140
SIQGSIVSPHTAATNGGYSRKKDGGFFST                                             141 - 169
//

Text Mined References (4)

PMID Year Title