Property Summary

NCBI Gene PubMed Count 5
PubMed Score 7.37
PubTator Score 5.60

Knowledge Summary


No data available


Accession Q6ZWK4
Symbols RHEX


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

25092874 RHEX(C1orf186) comprises a new EPO/EPOR target and regulator of erythroid cell expansion that additionally acts to support late-stage erythroblast development

AA Sequence

YVNVNPERHKPSFWYFVNPALSEPAEYDQVAM                                          141 - 172

Text Mined References (5)

PMID Year Title
25092874 2014 RHEX, a novel regulator of human erythroid progenitor cell expansion and erythroblast development.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.