Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
urothelial carcinoma -1.100 2.3e-04
type 2 diabetes -1.182 2.1e-02
pancreatic ductal adenocarcinoma liver m... -2.238 2.8e-03
interstitial cystitis -1.100 3.8e-03
lung adenocarcinoma -1.700 2.6e-11
posterior fossa group A ependymoma 1.700 3.6e-04
lung carcinoma -2.100 3.6e-10
non-small cell lung carcinoma -1.400 4.3e-12
ovarian cancer -5.300 8.0e-11
pituitary cancer -2.600 1.9e-06
chronic rhinosinusitis -3.065 7.2e-03
cystic fibrosis and chronic rhinosinusit... -1.043 3.0e-02

AA Sequence

MEGEGVRNFKELRAKFQNLDAPPLPGPIKFPAGVSPKGDIGGTQSTQILANGKPLSSNHKQRTPYCSSSE      1 - 70
SQPLQPQKIKLAQKSEIPKCSNSPGPLGKSTVCSATSSQKASLLLEVTQSNVEIITKEKVMVANSFRNKL     71 - 140
WNWEKVSSQKSEMSSALLLANYGSKAIHLEGQKGMGLTPEEPRKKLETKGAQTLPSQKHVVAPKILHNVS    141 - 210
EDPSFVISQHIRKSWENPPPERSPASSPCQPIYECELASQAPEKQPDVRHHHLPKTKPLPSIDSLGPPPP    211 - 280
KPSRPPIVNLQAFQRQPAAVPKTQGEVTVEEGSLSPERLFNAEFEEPHNYEATISYLRHSGNSINLCTAK    281 - 350
EIADPTYEVGIEELQKPGKNFPYPEPSAKHEDKKMKEKQPCELKPKNTEKEPYSNHVFKVDACEGTPEKI    351 - 420
QMTNVHTGRRNMLAGKQEAMIDIIQTNPCPEGPKLARHSQGHCGHLEVLESTKETPDLGVSKTSSISEEI    421 - 490
YDDVEYSRKEVPKLNYSSSLASSSEENRELYEDVYKTKNNYPKIDLDGKEALKRLQQFFKKEKDRFKIKK    491 - 560
TKSKENLSAFSILLPDLELKSQEVIIYDDVDLSEKESKDEDKLKMWKPKFLTPKEKKEKNGAEESESFSP    561 - 630
RNFFKTKKQNLEKNRMKREEKLFRERFKYDKEIIVINTAVACSNNSRNGIFDLPISPGEELEVIDTTEQN    631 - 700
LVICRNSKGKYGYVLIEHLDFKHQSWSP                                              701 - 728
//

Text Mined References (7)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22843503 2012 Genome-wide association analysis identifies TYW3/CRYZ and NDST4 loci associated with circulating resistin levels.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.