Property Summary

NCBI Gene PubMed Count 10
PubMed Score 34.99
PubTator Score 2.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
esophageal adenocarcinoma -1.600 3.2e-02
psoriasis 1.100 2.3e-03
non-small cell lung cancer -3.027 1.1e-16
intraductal papillary-mucinous adenoma (... 3.000 1.1e-04
intraductal papillary-mucinous carcinoma... 2.100 4.2e-03
intraductal papillary-mucinous neoplasm ... 2.700 1.4e-03
lung cancer -6.600 5.2e-08
pancreatic cancer 1.600 7.4e-05
interstitial cystitis -3.300 1.9e-04
lung adenocarcinoma -1.600 4.1e-04
nasopharyngeal carcinoma -2.900 9.8e-09
lung carcinoma -1.500 1.6e-11
spina bifida -2.359 4.3e-02
Breast cancer -1.600 1.7e-03
gastric carcinoma -1.400 4.6e-02
ovarian cancer 1.900 2.1e-04

Gene RIF (1)

PMID Text
15525603 SARG mRNA expression is high in prostate tissue. SARG is composed of four exons and spans a region of 14.5 kbp on chromosome 1q32.2.

AA Sequence

MPERELWPAGTGSEPVTRVGSCDSMMSSTSTRSGSSDSSYDFLSTEEKECLLFLEETIGSLDTEADSGLS      1 - 70
TDESEPATTPRGFRALPITQPTPRGGPEETITQQGRTPRTVTESSSSHPPEPQGLGLRSGSYSLPRNIHI     71 - 140
ARSQNFRKSTTQASSHNPGEPGRLAPEPEKEQVSQSSQPRQAPASPQEAALDLDVVLIPPPEAFRDTQPE    141 - 210
QCREASLPEGPGQQGHTPQLHTPSSSQEREQTPSEAMSQKAKETVSTRYTQPQPPPAGLPQNARAEDAPL    211 - 280
SSGEDPNSRLAPLTTPKPRKLPPNIVLKSSRSSFHSDPQHWLSRHTEAAPGDSGLISCSLQEQRKARKEA    281 - 350
LEKLGLPQDQDEPGLHLSKPTSSIRPKETRAQHLSPAPGLAQPAAPAQASAAIPAAGKALAQAPAPAPGP    351 - 420
AQGPLPMKSPAPGNVAASKSMPISIPKAPRANSALTPPKPESGLTLQESNTPGLRQMNFKSNTLERSGVG    421 - 490
LSSYLSTEKDASPKTSTSLGKGSFLDKISPSVLRNSRPRPASLGTGKDFAGIQVGKLADLEQEQSSKRLS    491 - 560
YQGQSRDKLPRPPCVSVKISPKGVPNEHRREALKKLGLLKE                                 561 - 601
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15525603 2004 A bioinformatics-based functional analysis shows that the specifically androgen-regulated gene SARG contains an active direct repeat androgen response element in the first intron.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9389513 1997 Both androgen receptor and glucocorticoid receptor are able to induce prostate-specific antigen expression, but differ in their growth-stimulating properties of LNCaP cells.