Property Summary

NCBI Gene PubMed Count 10
PubMed Score 34.99
PubTator Score 2.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.090771858237E-16
lung carcinoma 2844 1.583550334708E-11
nasopharyngeal carcinoma 1056 9.75414880728611E-9
lung cancer 4473 5.16884393615689E-8
pancreatic cancer 2300 7.42750972438097E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.0912042875607E-4
interstitial cystitis 2299 1.90279763796725E-4
ovarian cancer 8492 2.09301383635289E-4
lung adenocarcinoma 2714 4.11698466181396E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00138905082369837
Breast cancer 3099 0.00172714686946486
psoriasis 6685 0.00233515580746924
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00419866733695907
esophageal adenocarcinoma 737 0.0322436346138726
spina bifida 1064 0.0431872851649498
gastric carcinoma 832 0.0462337277712534

Expression

  Differential Expression (16)

Synonym

Accession Q9BW04 C9JV41 Q658X3
Symbols SARG

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (1)

PMID Text
15525603 SARG mRNA expression is high in prostate tissue. SARG is composed of four exons and spans a region of 14.5 kbp on chromosome 1q32.2.

AA Sequence

MPERELWPAGTGSEPVTRVGSCDSMMSSTSTRSGSSDSSYDFLSTEEKECLLFLEETIGSLDTEADSGLS      1 - 70
TDESEPATTPRGFRALPITQPTPRGGPEETITQQGRTPRTVTESSSSHPPEPQGLGLRSGSYSLPRNIHI     71 - 140
ARSQNFRKSTTQASSHNPGEPGRLAPEPEKEQVSQSSQPRQAPASPQEAALDLDVVLIPPPEAFRDTQPE    141 - 210
QCREASLPEGPGQQGHTPQLHTPSSSQEREQTPSEAMSQKAKETVSTRYTQPQPPPAGLPQNARAEDAPL    211 - 280
SSGEDPNSRLAPLTTPKPRKLPPNIVLKSSRSSFHSDPQHWLSRHTEAAPGDSGLISCSLQEQRKARKEA    281 - 350
LEKLGLPQDQDEPGLHLSKPTSSIRPKETRAQHLSPAPGLAQPAAPAQASAAIPAAGKALAQAPAPAPGP    351 - 420
AQGPLPMKSPAPGNVAASKSMPISIPKAPRANSALTPPKPESGLTLQESNTPGLRQMNFKSNTLERSGVG    421 - 490
LSSYLSTEKDASPKTSTSLGKGSFLDKISPSVLRNSRPRPASLGTGKDFAGIQVGKLADLEQEQSSKRLS    491 - 560
YQGQSRDKLPRPPCVSVKISPKGVPNEHRREALKKLGLLKE                                 561 - 601
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...