Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma -1.500 1.5e-05
astrocytoma -3.900 3.5e-04
ependymoma -3.900 9.5e-04
oligodendroglioma -3.000 2.5e-20
Barrett's esophagus 1.500 1.6e-02
esophageal adenocarcinoma 1.400 2.0e-02
psoriasis -1.500 6.6e-08
glioblastoma -4.500 6.4e-06
medulloblastoma -2.000 4.5e-03
atypical teratoid / rhabdoid tumor -2.600 9.8e-05
medulloblastoma, large-cell -3.600 1.8e-04
primitive neuroectodermal tumor -3.300 1.0e-04
non-small cell lung cancer -1.634 5.5e-19
breast carcinoma -1.200 2.6e-05
adult high grade glioma -3.100 4.1e-04
pilocytic astrocytoma -3.000 1.1e-06
acute myeloid leukemia -1.200 3.4e-02
lung adenocarcinoma -1.700 1.5e-10
invasive ductal carcinoma -2.000 8.3e-03
ulcerative colitis -1.500 3.4e-06
pituitary cancer 1.800 3.8e-05

Synonym

Accession Q9H7X2 B3KRN3 D3DTB2
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MTVGARLRSKAESSLLRRGPRGRGRTEGDEEAAAILEHLEYADEAEAAAESGTSAADERGPGTRGARRVH      1 - 70
FALLPERYEPLEEPAPSEQPRKRYRRKLKKYGKNVGKVIIKGCRYVVIGLQGFAAAYSAPFAVATSVVSF     71 - 140
VR                                                                        141 - 142
//

Text Mined References (6)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.