Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.99
PubTator Score 0.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MTQDRPLLAVQEALKKCFPVVEEQQGLWQSALRDCQPLLSSLSNLAEQLQAAQNLRFEDVPALRAFPDLK      1 - 70
ERLRRKQLVAGDIVLDKLGERLAILLKVRDMVSSHVERVFQIYEQHADTVGIDAVLQPSAVSPSVADMLE     71 - 140
WLQDIERHYRKSYLKRKYLLSSIQWGDLANIQALPKAWDRISKDEHQDLVQDILLNVSFFLEE           141 - 203
//

Text Mined References (10)

PMID Year Title