Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.76
PubTator Score 0.76

Knowledge Summary


No data available


  Differential Expression (25)

Disease log2 FC p
nephrosclerosis -1.152 5.7e-03
malignant mesothelioma 1.100 2.5e-04
astrocytic glioma 1.100 3.2e-03
oligodendroglioma 1.200 1.7e-02
osteosarcoma -1.821 2.4e-03
glioblastoma 2.400 9.9e-08
cystic fibrosis -1.352 8.5e-05
primitive neuroectodermal tumor 1.900 4.1e-03
pancreatic ductal adenocarcinoma liver m... 2.793 2.6e-02
non-small cell lung cancer 2.173 9.0e-24
intraductal papillary-mucinous adenoma (... 3.000 1.4e-04
intraductal papillary-mucinous carcinoma... 3.200 3.4e-04
intraductal papillary-mucinous neoplasm ... 3.400 1.4e-03
lung cancer -1.700 5.8e-04
pancreatic cancer 1.800 2.4e-06
interstitial cystitis -3.300 9.4e-05
pediatric high grade glioma 1.800 9.8e-05
atypical teratoid/rhabdoid tumor 1.300 5.8e-05
pilocytic astrocytoma 3.100 1.2e-08
lung adenocarcinoma 1.700 1.2e-06
nasopharyngeal carcinoma -1.100 6.2e-04
spina bifida -1.849 2.9e-02
ductal carcinoma in situ 2.900 3.7e-03
invasive ductal carcinoma 2.300 4.7e-03
ovarian cancer 2.900 6.1e-09

 Compartment GO Term (0)

 MGI Phenotype (1)

Pathway (1)

AA Sequence

RAQVPTVCVLRRSPDGAPVQVFVPEKGEIISQV                                         631 - 663

Text Mined References (12)

PMID Year Title
25082827 2014 A genome-wide association study identifies a novel locus at 6q22.1 associated with ulcerative colitis.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
19915572 2009 Genome-wide association study of ulcerative colitis identifies three new susceptibility loci, including the HNF4A region.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.