Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.20
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 2.6e-10
ovarian cancer 8491 1.6e-09
medulloblastoma, large-cell 6234 3.3e-04
adult high grade glioma 2148 3.0e-03
group 3 medulloblastoma 2254 2.4e-02
osteosarcoma 7933 3.5e-02
Disease Target Count Z-score Confidence
Abdominal aortic aneurysm 9 3.154 1.6
Disease Target Count
Non-immune hydrops fetalis 11

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.419 3.5e-02
medulloblastoma, large-cell 1.800 3.3e-04
adult high grade glioma 1.300 3.0e-03
group 3 medulloblastoma -1.100 2.4e-02
ovarian cancer 1.800 1.6e-09
psoriasis -1.200 2.6e-10

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEKRELKASVPKFDKIPWLSEASLVNKPLVLSLPRRYPHTSATFLTSSKKNMNLPILFQVPDVLSKARRN      1 - 70
QCDSMLLRNQQLCSTCQEMKMVQPRTMKIPDDPKASFENCMSYRMSLHQPKFQTTPEPFHDDIPTESIHY     71 - 140
RLPILGPRTAVFHGLLTEAYKTLKERQRSSLPRKEPIGKTTRQ                               141 - 183
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.