Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.34
PubTator Score 0.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 3.0e-08
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 2.2

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.600 3.0e-08

AA Sequence

MTAIRLREFIERRPVIPPSIFIAHQGRDVQGYYPGQLARLHFDHSAKRAPRPLIDLTIPPKTKYHYQPQL      1 - 70
DQQTLIRYICLRRHSKPAEPWYKETTYRRDYSLPFYEIDWNQKLATVSLNPRPLNSLPELYCCEERSSFE     71 - 140
RNAFKLK                                                                   141 - 147
//

Text Mined References (5)

PMID Year Title