Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.34
PubTator Score 0.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 3.0e-08
Disease Target Count Z-score Confidence
substance-related disorder 104 0.0 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.600 3.0e-08

Synonym

Accession Q5SVJ3 Q5SVJ4
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

AA Sequence

MTAIRLREFIERRPVIPPSIFIAHQGRDVQGYYPGQLARLHFDHSAKRAPRPLIDLTIPPKTKYHYQPQL      1 - 70
DQQTLIRYICLRRHSKPAEPWYKETTYRRDYSLPFYEIDWNQKLATVSLNPRPLNSLPELYCCEERSSFE     71 - 140
RNAFKLK                                                                   141 - 147
//

Text Mined References (5)

PMID Year Title
22832964 2012 Genome-wide meta-analyses of smoking behaviors in African Americans.
22560479 2012 Genome-wide association study of the age of onset of childhood asthma.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.