Property Summary

Ligand Count 77
NCBI Gene PubMed Count 59
PubMed Score 964.09
PubTator Score 483.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
cystic fibrosis 1696
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Melanoma 711 0.0 0.5
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Ehlers-Danlos syndrome 43 0.0 4.0

Expression

  Differential Expression (38)

Disease log2 FC p
acute quadriplegic myopathy 1.610 1.5e-05
adrenocortical carcinoma -1.399 1.4e-02
adult high grade glioma 1.500 1.6e-03
Astrocytoma, Pilocytic 2.300 1.5e-05
Atopic dermatitis -1.900 2.3e-02
autosomal dominant Emery-Dreifuss muscul... 1.426 4.1e-03
Becker muscular dystrophy 1.111 3.9e-03
chronic kidney disease 1.600 1.7e-02
colon cancer -1.200 9.6e-03
cystic fibrosis 1.484 7.1e-05
dermatomyositis 2.000 2.2e-03
diabetes mellitus -1.500 1.8e-03
Duchenne muscular dystrophy 1.913 3.3e-09
ependymoma 2.300 1.7e-04
esophageal adenocarcinoma 1.400 3.5e-02
gastric carcinoma 1.600 5.2e-03
glioblastoma 2.300 3.6e-03
head and neck cancer and chronic obstruc... 1.200 5.5e-04
intraductal papillary-mucinous adenoma (... -2.600 4.0e-03
intraductal papillary-mucinous carcinoma... -3.200 1.5e-03
intraductal papillary-mucinous neoplasm ... -3.500 9.2e-03
invasive ductal carcinoma -1.400 1.8e-03
juvenile dermatomyositis 2.232 7.6e-16
limb girdle muscular dystrophy 2A 1.679 6.3e-07
lung cancer -1.100 5.1e-03
lung carcinoma -3.200 3.4e-24
malignant mesothelioma -1.900 8.5e-08
medulloblastoma, large-cell -1.200 2.0e-03
non-small cell lung cancer 1.323 6.0e-04
ovarian cancer -3.100 1.2e-19
pancreatic cancer 1.900 8.8e-05
pancreatic ductal adenocarcinoma liver m... -1.714 2.6e-02
pituitary cancer -1.800 9.3e-04
primary Sjogren syndrome 2.100 4.1e-03
psoriasis 1.400 6.9e-04
sonic hedgehog group medulloblastoma 1.600 8.9e-03
subependymal giant cell astrocytoma 2.514 3.7e-03
ulcerative colitis 2.800 1.7e-04

Protein-protein Interaction (3)

Gene RIF (16)

AA Sequence

MWCIVLFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIELSENCAYDSV      1 - 70
QIISGDTEEGRLCGQRSSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERFTGFAAYYVATDINECTDFVD     71 - 140
VPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVFTALIGEIASPNYPKPYPENSRCEYQIRLEK    141 - 210
GFQVVVTLRREDFDVEAADSAGNCLDSLVFVAGDRQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQK    211 - 280
KGWKLRYHGDPMPCPKEDTPNSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNS    281 - 350
KLKCQPVDCGIPESIENGKVEDPESTLFGSVIRYTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPK    351 - 420
CVPVCGVPREPFEEKQRIIGGSDADIKNFPWQVFFDNPWAGGALINEYWVLTAAHVVEGNREPTMYVGST    421 - 490
SVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVKMGPTVSPICLPGTSSDYNLM    491 - 560
DGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKVEKPTADAEAYVFTPNMICAGGEKGMDSCKG    561 - 630
DSGGAFAVQDPNDKTKFYAAGLVSWGPQCGTYGLYTRVKNYVDWIMKTMQENSTPRED                631 - 688
//

Text Mined References (61)

PMID Year Title