Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.27
PubTator Score 2.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Atopic dermatitis -1.800 6.3e-04
non-small cell lung cancer -2.124 1.4e-23
intraductal papillary-mucinous adenoma (... -2.900 1.3e-03
intraductal papillary-mucinous carcinoma... -3.400 6.0e-04
intraductal papillary-mucinous neoplasm ... -3.600 5.2e-03
fibroadenoma -1.100 4.4e-02
interstitial cystitis -1.400 3.9e-02
lung adenocarcinoma -1.700 3.4e-26
psoriasis -1.900 2.6e-52
lung carcinoma -1.600 7.5e-14
ductal carcinoma in situ -1.500 3.2e-02
invasive ductal carcinoma -1.900 2.6e-02
ovarian cancer -1.900 6.9e-06
pituitary cancer 1.200 1.0e-02
head and neck cancer -2.000 3.1e-02

Gene RIF (3)

PMID Text
20585324 found four markers that meet the criteria for genome-wide significance (P<5x10-8) with the CD symptom count, two of which are located in the gene C1QTNF7 (C1q and tumor necrosis factor-related protein 7).
20585324 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19344414 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFVLLYVTSFAICASGQPRGNQLKGENYSPRYICSIPGLPGPPGPPGANGSPGPHGRIGLPGRDGRDGRK      1 - 70
GEKGEKGTAGLRGKTGPLGLAGEKGDQGETGKKGPIGPEGEKGEVGPIGPPGPKGDRGEQGDPGLPGVCR     71 - 140
CGSIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGIYYFSYDITLANKHLAIGL    141 - 210
VHNGQYRIKTFDANTGNHDVASGSTVIYLQPEDEVWLEIFFTDQNGLFSDPGWADSLFSGFLLYVDTDYL    211 - 280
DSISEDDEL                                                                 281 - 289
//

Text Mined References (9)

PMID Year Title
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
20585324 2011 Genome-wide association study of conduct disorder symptomatology.
19344414 2009 Risk of non-Hodgkin lymphoma in association with germline variation in complement genes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.