Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.41
PubTator Score 2.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.000 2.4e-02
ependymoma -3.800 5.9e-17
glioblastoma -4.000 9.1e-07
oligodendroglioma -1.800 1.1e-14
sonic hedgehog group medulloblastoma -2.400 1.4e-04
atypical teratoid / rhabdoid tumor -2.600 7.5e-05
medulloblastoma, large-cell -3.400 1.4e-05
primitive neuroectodermal tumor -1.900 4.9e-04
adult high grade glioma -4.300 1.2e-07
pilocytic astrocytoma -3.400 4.7e-09
subependymal giant cell astrocytoma -2.369 8.2e-03
Pick disease -1.300 2.2e-02
mucosa-associated lymphoid tissue lympho... -1.106 6.1e-03
pituitary cancer -1.500 3.9e-04

Gene RIF (2)

PMID Text
24366864 These results establish CTRP4 as a novel nutrient-responsive central regulator of food intake and energy balance.
21658842 CTRP4 is a novel tumor-promoting inflammatory regulator.

AA Sequence

MLPLLLGLLGPAACWALGPTPGPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGDFDVATGQFRC      1 - 70
RVPGAYFFSFTAGKAPHKSLSVMLVRNRDEVQALAFDEQRRPGARRAASQSAMLQLDYGDTVWLRLHGAP     71 - 140
QYALGAPGATFSGYLVYADADADAPARGPPAPPEPRSAFSAARTRSLVGSDAGPGPRHQPLAFDTEFVNI    141 - 210
GGDFDAAAGVFRCRLPGAYFFSFTLGKLPRKTLSVKLMKNRDEVQAMIYDDGASRRREMQSQSVMLALRR    211 - 280
GDAVWLLSHDHDGYGAYSNHGKYITFSGFLVYPDLAPAAPPGLGASELL                         281 - 329
//

Text Mined References (5)

PMID Year Title
24366864 2014 C1q/TNF-related protein 4 (CTRP4) is a unique secreted protein with two tandem C1q domains that functions in the hypothalamus to modulate food intake and body weight.
21658842 2011 Identification of C1qTNF-related protein 4 as a potential cytokine that stimulates the STAT3 and NF-?B pathways and promotes cell survival in human cancer cells.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.