Property Summary

NCBI Gene PubMed Count 34
PubMed Score 248.30
PubTator Score 57.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 3.1e-03
Atopic dermatitis -1.200 4.9e-04
cutaneous lupus erythematosus -1.300 8.2e-03
invasive ductal carcinoma 1.668 3.2e-03
lung cancer -1.200 1.1e-02
ovarian cancer 2.200 1.4e-02
posterior fossa group A ependymoma 1.400 1.1e-04

Synonym

Accession Q9BXJ4 Q0VAN4 Q542Y2 Q6MZN1 Q96KY1
Symbols CORS
CORCS
CTRP3
CORS26
C1ATNF3
CORS-26

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (26)

AA Sequence

MLWRQLIYWQLLALFFLPFCLCQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGN      1 - 70
NGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSV     71 - 140
ETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVL    141 - 210
KLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK                                      211 - 246
//

Text Mined References (38)

PMID Year Title