Property Summary

NCBI Gene PubMed Count 25
PubMed Score 19.92
PubTator Score 13.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma -1.154 7.6e-04
Astrocytoma, Pilocytic 1.200 6.2e-05
ductal carcinoma in situ -1.200 6.1e-03
interstitial cystitis 1.100 9.1e-04
invasive ductal carcinoma -1.600 9.7e-03
malignant mesothelioma -3.500 4.8e-08
subependymal giant cell astrocytoma 1.011 4.4e-02

 GO Function (1)

Gene RIF (17)

AA Sequence

MGSRGQGLLLAYCLLLAFASGLVLSRVPHVQGEQQEWEGTEELPSPPDHAERAEEQHEKYRPSQDQGLPA      1 - 70
SRCLRCCDPGTSMYPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGSMGAPGER     71 - 140
CKSHYAAFSVGRKKPMHSNHYYQTVIFDTEFVNLYDHFNMFTGKFYCYVPGLYFFSLNVHTWNQKETYLH    141 - 210
IMKNEEEVVILFAQVGDRSIMQSQSLMLELREQDQVWVRLYKGERENAIFSEELDTYITFSGYLVKHATE    211 - 280
P//

Text Mined References (26)

PMID Year Title