Property Summary

NCBI Gene PubMed Count 60
PubMed Score 17.85
PubTator Score 11.44

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (2)

Gene RIF (47)

AA Sequence

MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRG      1 - 70
PKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRF     71 - 140
NAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLR    141 - 210
LQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD                                       211 - 245
//

Text Mined References (60)

PMID Year Title