Property Summary

NCBI Gene PubMed Count 59
PubMed Score 17.48
PubTator Score 11.44

Knowledge Summary

Patent

No data available

Expression

Gene RIF (47)

PMID Text
25109258 Neuromyelitis optica patients had higher levels of C3a and anti-C1q antibodies than healthy controls.
24157463 C1q deficiency due to a Gly164Ser mutation may have a role in Rothmund-Thomson syndrome and glomerulonephritis [case report]
23720782 Data indicate that Cna binds to C1q.
23650384 Analysis of its interaction properties by surface plasmon resonance shows that rC1q retains the ability of serum C1q to associate with the C1s-C1r-C1r-C1s tetramer, to recognize physiological C1q ligands such as IgG and pentraxin 3
23607884 Single nucleotide polymorphisms in and around the C1q genes, C1qA, C1qB and C1qC, correlated with C1q serum levels and may be a risk for the development of rheumatoid arthritis.
22740328 We identified a major linear epitope of C1q that is the target of anti-C1q in systemic lupus erythematosus.
22264191 C1q and C1q receptor interaction may be responsible for the C1q-mediated migration of mesenchymal stromal cells.
21862594 analysis of the molecular mechanisms for synchronized transcription of three complement C1q subunit genes (A, B and C) in dendritic cells and macrophages
20833838 These results suggest a novel pathway in which C1q and MBL influence removal and metabolism of atherogenic forms of LDL in the early stages of atherosclerosis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20528885 In a large family-based association study of C1Q gene cluster polymorphisms no evidence for a genetic role of C1Q locus SNP in systemic lupus erythematosus risk predisposition was obtained in patients of European ancestry.
20528885 Observational study of gene-disease association. (HuGE Navigator)
20438785 Three single nucleotide polymorphisms (STAT6 rs703817, C1qG rs17433222, and MBP rs3794845) were found to be significantly associated with childhood leukemia risk in Koreans.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20139276 Data show that C1q, C4, C3, and C9 bind to thrombin receptor-activating peptide-activated platelets in lepirudin-anticoagulated platelet-rich plasma (PRP) and whole blood.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19790049 C1q deficiency is such a strong risk factor for systemic lupus erythematosus.
19710097 prevents monocyte-derived dendritic cell differentiation
19493541 C1QC (rs9434) correlates with later age of onset in TTR Val30Met familial amyloidotic polyneuropathy. C1QC (rs15940) does not.
19493541 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19344414 Observational study of gene-disease association. (HuGE Navigator)
19115936 Complement protein C1q and anti-hexon antibodies together can mediate efficient adenovirus infection in coxsackie and adenovirus receptor-negative cell types.
18838169 Complement C1q chemoattracts human dendritic cells and enhances migration of mature dendritic cells to CCL19 via activation of AKT and MAPK pathways.(
18703056 The peripheral globular region of the C1q molecule displays a lectin-like activity, which contributes to DNA binding through interaction with its deoxy-d-ribose moiety and may participate in apoptotic cell recognition.
18505047 Observational study of gene-disease association. (HuGE Navigator)
18504288 C1q polymorphisms are associated with SLE, serum C1q and CH50 levels in a stable founder population of patients with SLE.
18174230 Observational study of gene-disease association. (HuGE Navigator)
16566583 results suggest that charged residues belonging to the apex of the gC1q heterotrimer (with participation of all three chains) as well as the side of the ghB are crucial for C1q binding to ligands, IgG1, C-reactive protein, and pentraxin 3
15034050 Complementary interacting sites on the C1q globular domain have been precisely defined. Characterization of point mutants suggests a complementary role for Arg156 of C1Q C chain in the C1q-IgG interaction.
12960167 The structure refined to 1.9 A of resolution of C1q reveals the conformation of subunits A, B, and C and their compact, almost spherical heterotrimeric assembly held together mainly by non-polar interactions, with a Ca2+ ion bound at the top.
12847249 The C-terminal globular region of the C1Q C chain may have evolved as a functionally specialized domain or module with distinct binding properties which together with the A and B chains confers versatility and flexibility to the whole C1q molecule.
12645945 Experiments with recombinant globular head domains of human C1q A, B, and C chains indicated that C1q interacts with PTX3 via its globular head region. Binding of C1q to immobilized PTX3 induced activation of the classical complement pathway.
12396016 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
11318594 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
10504397 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
9443108 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
8252810 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
8245486 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
7739575 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
7642209 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
7590886 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
7507842 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
1875953 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese
1744579 The interaction between C1q and HIV-gp41 is dependent upon the presence of calcium; calcium can not be replaced by larger cations such as strontium, barium, lead or smaller ions such as magnesium and manganese

AA Sequence

MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRG      1 - 70
PKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRF     71 - 140
NAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLR    141 - 210
LQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD                                       211 - 245
//

Text Mined References (59)

PMID Year Title
26410546 2015 Fundamental role of C1q in autoimmunity and inflammation.
26175731 2015 Emerging and Novel Functions of Complement Protein C1q.
25109258 2014 Complement activation in patients with neuromyelitis optica.
24157463 2014 Rothmund-Thomson syndrome and glomerulonephritis in a homozygous C1q-deficient patient due to a Gly164Ser C1qC mutation.
23720782 2013 Collagen-binding microbial surface components recognizing adhesive matrix molecule (MSCRAMM) of Gram-positive bacteria inhibit complement activation via the classical pathway.
23650384 2013 Expression of recombinant human complement C1q allows identification of the C1r/C1s-binding sites.
23607884 2013 Genetic variants in the region of the C1q genes are associated with rheumatoid arthritis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22740328 2012 Identification of a major linear C1q epitope allows detection of systemic lupus erythematosus anti-C1q antibodies by a specific peptide-based enzyme-linked immunosorbent assay.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22264191 2012 Mesenchymal stromal cells derived from umbilical cord blood migrate in response to complement C1q.
21862594 2011 Molecular mechanisms for synchronized transcription of three complement C1q subunit genes in dendritic cells and macrophages.
20833838 2010 Innate immune proteins C1q and mannan-binding lectin enhance clearance of atherogenic lipoproteins by human monocytes and macrophages.
20635792 2010 Homozygosity for a novel mutation in the C1q C chain gene in a Turkish family with hereditary C1q deficiency.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20528885 2010 Assessing association of common variation in the C1Q gene cluster with systemic lupus erythematosus.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20139276 2010 Complement component C3 binds to activated normal platelets without preceding proteolytic activation and promotes binding to complement receptor 1.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19790049 2009 C1q inhibits immune complex-induced interferon-alpha production in plasmacytoid dendritic cells: a novel link between C1q deficiency and systemic lupus erythematosus pathogenesis.
19710097 2010 Evidence that a C1q/C1qR system regulates monocyte-derived dendritic cell differentiation at the interface of innate and acquired immunity.
19493541 2009 Complement C1Q polymorphisms modulate onset in familial amyloidotic polyneuropathy TTR Val30Met.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19344414 2009 Risk of non-Hodgkin lymphoma in association with germline variation in complement genes.
19115936 2008 Complement component C1q and anti-hexon antibody mediate adenovirus infection of a CAR-negative cell line.
18838169 2008 Complement C1q chemoattracts human dendritic cells and enhances migration of mature dendritic cells to CCL19 via activation of AKT and MAPK pathways.
18703056 2008 The lectin-like activity of human C1q and its implication in DNA and apoptotic cell recognition.
18505047 2008 PCR-RFLP genotyping of C1q mutations and single nucleotide polymorphisms in Malaysian patients with systemic lupus erythematosus.
18504288 2009 Analysis of C1q polymorphisms suggests association with systemic lupus erythematosus, serum C1q and CH50 levels and disease severity.
18174230 2008 Association of polymorphisms in complement component C3 gene with susceptibility to systemic lupus erythematosus.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16566583 2006 Interaction of C1q with IgG1, C-reactive protein and pentraxin 3: mutational studies using recombinant globular head modules of human C1q A, B, and C chains.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15353007 2004 The FK506 binding protein 13 kDa (FKBP13) interacts with the C-chain of complement C1q.
15034050 2004 Mutational analyses of the recombinant globular regions of human C1q A, B, and C chains suggest an essential role for arginine and histidine residues in the C1q-IgG interaction.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12960167 2003 The crystal structure of the globular head of complement protein C1q provides a basis for its versatile recognition properties.
12847249 2003 Modular organization of the carboxyl-terminal, globular head region of human C1q A, B, and C chains.
12645945 2003 Biochemical and functional characterization of the interaction between pentraxin 3 and C1q.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10961870 2000 Adiponectin, a new member of the family of soluble defense collagens, negatively regulates the growth of myelomonocytic progenitors and the functions of macrophages.
9777412 1998 Molecular basis of hereditary C1q deficiency.
8630118 1996 Homozygous hereditary C1q deficiency and systemic lupus erythematosus. A new family and the molecular basis of C1q deficiency in three families.
7939135 1994 Expression of the components and regulatory proteins of the classical pathway of complement in normal and diseased synovium.
7594474 1995 Non-sense and missense mutations in the structural genes of complement component C1q A and C chains are linked with two different types of complete selective C1q deficiencies.
3180845 1988 Mapping of 12 translocation breakpoints in the Xp21 region with respect to the locus for Duchenne muscular dystrophy.
1706597 1991 Characterization and organization of the genes encoding the A-, B- and C-chains of human complement subcomponent C1q. The complete derived amino acid sequence of human C1q.
1537612 1992 Localization of the gene cluster encoding the A, B, and C chains of human C1q to 1p34.1-1p36.3.
1249422 1976 Activation of C1r by proteolytic cleavage.
814163 1976 Physicochemical and functional characterization of the C1r subunit of the first complement component.
486087 1979 Complete amino acid sequences of the three collagen-like regions present in subcomponent C1q of the first component of human complement.