Property Summary

NCBI Gene PubMed Count 117
PubMed Score 332.59
PubTator Score 188.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.317 2.5e-02
Multiple myeloma 1.820 3.7e-03
psoriasis 1.200 2.4e-04
glioblastoma 1.200 1.3e-02
pancreatic ductal adenocarcinoma liver m... -1.668 6.7e-03
lung cancer 2.200 1.5e-05
non primary Sjogren syndrome sicca 1.100 1.3e-02
nasopharyngeal carcinoma 1.100 3.3e-03
lung adenocarcinoma 1.129 7.5e-05
ovarian cancer 2.600 2.3e-05

Gene RIF (78)

PMID Text
26753982 C1QBP interacts with DLAT and regulates the enzyme activity of pyruvate dehydrogenase.
26497555 Sp1-ZNF32-C1QBP axis protects against oxidative stress/apoptosis in hepatocellular carcinoma cells.
26085152 p32 appeared to be a core component of herpesvirus nuclear egress complexes, like UL31 and UL34 homologs in other herpesviruses, and to play multiple roles in herpesvirus nuclear egress.
25909887 Findings highlight a cytoprotective role of p32 under starvation conditions by regulating ULK1 stability, and uncover a crucial role of the p32-ULK1-autophagy axis in coordinating stress response, cell survival and mitochondrial homeostasis.
25794640 HABP1 protein high expression may contribute to the tumor progression and poor prognosis of TNBC, especially in predicting prognosis in TNBCs without lymph node metastasis.
25573962 our findings suggest that the C1QBP protein could be a potential proliferative marker in breast cancer
25528767 Data show that p32 hyaluronan binding protein (p32) is a direct transcriptional target of oncogene Myc and that high level of Myc in malignant brain cancers correlates with high expression of p32.
25497084 data suggest that C1QBP is a novel regulator of YBX1, and the expression of C1QBP and the nuclear expression of YBX1 could both be used as independent prognostic makers for cancer progression in the RCC patients
25355598 Our results indicated that overexpression of HABP1 may serve as a new biomarker to predict the progression and prognosis of endometrial cancer.
25355318 Interaction between HSV-1 ICP34.5 and p32 leads to the disintegration of nuclear lamina and facilitates the nuclear egress of HSV-1 particles.
25091479 By binding to p32, Mcl-1 can interfere with the uniporter function, thus inhibit the mitochondrial Ca(2+) uploading. This may provide a novel mechanism to explain the anti-apoptotic function of Mcl-1.
25061661 This suggests the importance of HABP1 induced HA cable formation in enhancing tumor potency by maintaining the oxidant levels and subsequent autophagic vacuolation.
24874554 The data suggest that p32 expression is important for trophoblast proliferation, via a mechanism involving regulation of normal mitochondrial function.
24174616 this data suggest a novel protective mechanism of p33 in modulating innate immune response by neutralizing cytotoxic AMPs at the host cell surface.
23990920 RNase H1 and protein P32 are involved in mitochondrial pre-rRNA processing
23929393 Data indicate that hyaluronic acid binding protein 1 (HABP1)/P32/C1QBP overexpression correlated with peritoneal dissemination and lymph node metastasis in EOC.
23924515 C1QBP was observed to be overexpressed in breast cancer tissues, and its expression level was closely linked with distant metastasis and TNM stages.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of complement component 1, q subcomponent binding protein (C1QBP) expression by HIV-1 Vpr in Vpr transduced macrophages
23692256 Studies highlight the critical contributions of the p32 protein to the morphology of mitochondria and ER under normal cellular conditions, as well as important roles of the p32 protein in cellular metabolism and various stress responses.
22960332 polymorphisms in HABP1 are potentially involved in glaucomatous neurodegeneration.
22771308 in ovarian serous carcinoma, HABP1 overexpression was correlated to histological-differentiation, residual tumor-size, serum CA-125 and stage; increased expression associated with cisplatin resistance; HAPBP1 overexpression in primary ovarian carcinomas is related to decrease in overall survival and progression free survival
22700724 C1q/gC1qR may regulate dendritic cells differentiation and function through the DC-SIGN-mediated induction of cell-signaling pathways.
22451658 Overexpression of hyaluronan-binding protein 1 (HABP1/p32/gC1qR) in HepG2 cells leads to increased hyaluronan synthesis and cell proliferation by up-regulation of cyclin D1 in AKT-dependent pathway.
22101277 C1qbp is upregulated in human lung and colon cancer cell lines and tumors.
22008525 we have identified a mitochondrial protein p32 as a novel interactor of parkin in the brain
21725590 gC1qR could play an important role in HPV-16-induced cervical cancer immune evasion depending on its level of expression and subcellular localisation.
21627988 HABP1 interacts with cell surface receptor integrin alphaVbeta3 that induces cell migration and tumor growth mediated by transcription factor NF-kappa B, membrane type-1 matrix metalloproteinase and matrix metalloprotease-2.
21559373 there is a a role for platelet-mediated clumping, rosetting and adhesion to gC1qR in the pathogenesis of severe malaria
21536856 p32 is a new rRNA maturation factor involved in the remodeling from pre-90S particles to pre-40S and pre-60S particles that requires the exchange of FBL for Nop52.
21536672 cell-surface gC1qR regulates lamellipodia formation and metastasis via receptor tyrosine kinase activation.
21248045 The data presented suggest that p32 fulfills an essential function for rubella virus replication in directing trafficking of mitochondria near sites of viral replication to meet the energy demands of the virus.
21205079 p32 is highly expressed in prostate tumor samples and its expression is significantly associated with the Gleason score, pathological stage and relapse
21156793 the potential of p32 for antibody-based tumor targeting strategies and the utility of the 2.15 antibody as targeting moiety for the selective delivery of imaging and therapeutic agents to tumors.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20617170 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of complement component 1, q subcomponent binding protein (C1QBP) expression by HIV-1 Vpr in Vpr transduced macrophages
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20100866 Knocking down p32 expression in human cancer cells strongly shifts their metabolism from oxidative phosphorylation (OXPHOS) to glycolysis.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19828637 Dysregulated shedding of C1q-R molecules contributes to vascular cryoglobulin-induced damage via the classic complement-mediated pathway in chronically hepatitis C-infected patients, with and without mixed cryoglobulinemia.
19565630 HABP1 mRNA expression level was a significant factor for predicting breast cancer prognosis
19473882 results suggest that HCV infection expands gC1qR+CD4+ T cells, which increase the susceptibility to core-mediated immune dysregulation and facilitate the establishment of HCV persistency
19454010 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of complement component 1, q subcomponent binding protein (C1QBP) expression by HIV-1 Vpr in Vpr transduced macrophages
19423540 Observational study of gene-disease association. (HuGE Navigator)
19190731 Cryoglobulins were present in over 90% of Chikungunya infection patients. Cryoglobulin frequency and levels decreased with time in recovering patients.
19164550 gC1qR is a physiological inhibitor of the RIG-I and MDA5-mediated antiviral signaling pathway
19149558 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of complement component 1, q subcomponent binding protein (C1QBP) expression by HIV-1 Vpr in Vpr transduced macrophages
19004836 Evidence for inhibitory interaction of hyaluronan-binding protein 1 (HABP1/p32/gC1qR) with Streptococcus pneumoniae hyaluronidase.
18757437 results establish p32, particularly its cell-surface-expressed form, as a new marker of tumor cells and tumor-associated macrophages/myeloid cells in hypoxic/metabolically deprived areas of tumors
18676636 Failure of p32 to interact with FOXC1 containing the disease-causing F112S mutation indicates that impaired protein interaction may be a disease mechanism for AR malformations.
18538737 Mitochondrial p32/C1QBP is a critical mediator of p14ARF-induced apoptosis.
18460468 Differential isoform expression and interaction with the P32 regulatory protein controls the subcellular localization of the splicing factor U2AF26
18358546 Data demonstrated a direct and specific interaction between vasopressin V2 receptor and GC1q-Rthese two proteins via the arginine cluster of vasopressin V2 receptor.
17907801 P. falciparum-infected red blood cells use the 32-kDa human protein gC1qR/HABP1/p32 as a receptor to bind to human brain microvascular endothelial cells.
17892212 These data suggest a role for gC1qR in the initial stages of Bacillus cereus spore attachment and/or entry.
17881511 Engagement of gC1qR on dendritic cells by hepatitis C virus core protein limits the induction of Th1 responses by inhibiting TLR-induced IL-12 production and may contribute to viral persistence.
17676665 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of complement component 1, q subcomponent binding protein (C1QBP) expression by HIV-1 Vpr in Vpr transduced macrophages
16893067 Data suggest that gC1qR serves as a molecular bridge between the complement and contact activation systems and is an important catalyst in inflammation.
16871385 we speculate that the epitope of gC1qR is unmasked in the germ cell lineage; by reducing gC1qR by siRNA, an increase was observed in the number of apoptotic cells in ITO-II & TCam-2 cell lines showing an antiapoptotic property of gC1qR in the germ cells
16641292 p32 overexpression effectively blocks mRNA accumulation from the adenovirus major late transcription unit (MLTU) and stimulates RNA polymerase II carboxy-terminal domain phosphorylation in virus-infected cells.
16537587 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of complement component 1, q subcomponent binding protein (C1QBP) expression by HIV-1 Vpr in Vpr transduced macrophages
16177118 gC1qR down-regulates interleukin-12 production by signaling through 1-phosphatidylinositol 3-kinase. This is the first report to identify signaling pathways used by gC1qR-mediated immune suppression.
16164755 These studies suggest that HCV core protein can lead to enhanced p38- and gC1qR-dependent IL-8 expression.
16140380 C1q functions as a chemotactic factor for immature dendritic cells, and migration is mediated through ligation of both gC1qR and cC1qR/CR.
16039650 HABP1 expression in Schizosaccharomyces pombe induces growth inhibition, morphological abnormalities like elongation, multinucleation and aberrant cell septum formation, implicating its role in cell cycle progression and cytokinesis
15467913 data suggest that gC1qR may participate in tissue remodeling and inflammation by localizing TFPI-2 to the pericellular environment to modulate local protease activity and regulate High Molecular Weight Kininogen activation
15243141 Human p32 functions as a corepressor of CCAAT-binding factor-mediated transcription activation.
15163734 binds with Hepacivirus core protein on CD8+ and CD4+ positive t-cells and inactivates lck and akt.
12833064 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of complement component 1, q subcomponent binding protein (C1QBP) expression by HIV-1 Vpr in Vpr transduced macrophages
12574814 gC1qR expressed on activated platelets may contribute directly to thrombosis, inflammation, and endovascular infections.
12538033 Maturation-dependent expression of this protein in monocyte-derived dendritic cells.
12443542 presence of homologous sequences of HABP1 cDNA, termed processed HABP1 pseudogene, in humans
12220632 demonstrate that MT1-MMP via its cytoplasmic tail directly associates with a chaperone-like compartment-specific regulator gC1qR
11870091 increase in expression over the rostral portion of the sperm head after capacitation; may play a role in human fertilization
8626563 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of complement component 1, q subcomponent binding protein (C1QBP) expression by HIV-1 Vpr in Vpr transduced macrophages
8189522 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of complement component 1, q subcomponent binding protein (C1QBP) expression by HIV-1 Vpr in Vpr transduced macrophages
7778269 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of complement component 1, q subcomponent binding protein (C1QBP) expression by HIV-1 Vpr in Vpr transduced macrophages

AA Sequence

MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCG      1 - 70
CGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIP     71 - 140
PTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVS    141 - 210
FQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVK    211 - 280
SQ                                                                        281 - 282
//

Text Mined References (134)

PMID Year Title
26753982 2016 Identification of a novel mitochondrial interacting protein of C1QBP using subcellular fractionation coupled with CoIP-MS.
26497555 2015 ZNF32 protects against oxidative stress-induced apoptosis by modulating C1QBP transcription.
26085152 2015 Role of Host Cell p32 in Herpes Simplex Virus 1 De-Envelopment during Viral Nuclear Egress.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25909887 2015 Chaperone-like protein p32 regulates ULK1 stability and autophagy.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25794640 2015 Elevated expression of HABP1 is a novel prognostic indicator in triple-negative breast cancers.
25573962 2015 Complement component 1, q subcomponent binding protein is a marker for proliferation in breast cancer.
25528767 2015 Mitochondrial p32 is upregulated in Myc expressing brain cancers and mediates glutamine addiction.
25497084 2015 C1QBP negatively regulates the activation of oncoprotein YBX1 in the renal cell carcinoma as revealed by interactomics analysis.
25355598 2015 Overexpression of HABP1 correlated with clinicopathological characteristics and unfavorable prognosis in endometrial cancer.
25355318 2014 p32 is a novel target for viral protein ICP34.5 of herpes simplex virus type 1 and facilitates viral nuclear egress.
25091479 2014 p32, a novel binding partner of Mcl-1, positively regulates mitochondrial Ca(2+) uptake and apoptosis.
25061661 2014 Increased hyaluronan levels in HABP1/p32/gC1qR overexpressing HepG2 cells inhibit autophagic vacuolation regulating tumor potency.
24955142 2014 Exploration of panviral proteome: high-throughput cloning and functional implications in virus-host interactions.
24874554 2014 A role for the mitochondrial-associated protein p32 in regulation of trophoblast proliferation.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24174616 2013 p33 (gC1q receptor) prevents cell damage by blocking the cytolytic activity of antimicrobial peptides.
23990920 2013 Human RNase H1 is associated with protein P32 and is involved in mitochondrial pre-rRNA processing.
23986595 2013 A host YB-1 ribonucleoprotein complex is hijacked by hepatitis C virus for the control of NS3-dependent particle production.
23929393 2013 Elevated expression of hyaluronic acid binding protein 1 (HABP1)/P32/C1QBP is a novel indicator for lymph node and peritoneal metastasis of epithelial ovarian cancer patients.
23924515 2013 Interactome analysis reveals that C1QBP (complement component 1, q subcomponent binding protein) is associated with cancer cell chemotaxis and metastasis.
23692256 2013 p32 protein levels are integral to mitochondrial and endoplasmic reticulum morphology, cell metabolism and survival.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22960332 2012 Genetic association and gene-gene interaction of HAS2, HABP1 and HYAL3 implicate hyaluronan metabolic genes in glaucomatous neurodegeneration.
22771308 2013 Significance of hyaluronan binding protein (HABP1/P32/gC1qR) expression in advanced serous ovarian cancer patients.
22700724 2012 DC-SIGN, C1q, and gC1qR form a trimolecular receptor complex on the surface of monocyte-derived immature dendritic cells.
22451658 2012 Overexpression of hyaluronan-binding protein 1 (HABP1/p32/gC1qR) in HepG2 cells leads to increased hyaluronan synthesis and cell proliferation by up-regulation of cyclin D1 in AKT-dependent pathway.
22238231 2012 Binding of cellular p32 protein to the rubella virus P150 replicase protein via PxxPxR motifs.
22118625 2011 NONO and RALY proteins are required for YB-1 oxaliplatin induced resistance in colon adenocarcinoma cell lines.
22101277 2011 The mitochondrial protein C1qbp promotes cell proliferation, migration and resistance to cell death.
22008525 2011 p32 regulates mitochondrial morphology and dynamics through parkin.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21725590 2011 The role of gC1qR in regulating survival of human papillomavirus 16 oncogene-transfected cervical cancer cells.
21627988 2011 Hyaluronan-binding protein 1 (HABP1/p32/gC1qR) induces melanoma cell migration and tumor growth by NF-kappa B dependent MMP-2 activation through integrin ?(v)?(3) interaction.
21559373 2011 Association of severe malaria outcomes with platelet-mediated clumping and adhesion to a novel host receptor.
21544310 2011 Interaction of high-molecular-weight kininogen with endothelial cell binding proteins suPAR, gC1qR and cytokeratin 1 determined by surface plasmon resonance (BiaCore).
21536856 2011 Splicing factor 2-associated protein p32 participates in ribosome biogenesis by regulating the binding of Nop52 and fibrillarin to preribosome particles.
21536672 2011 Cell-surface receptor for complement component C1q (gC1qR) is a key regulator for lamellipodia formation and cancer metastasis.
21269460 2011 Initial characterization of the human central proteome.
21248045 2011 Involvement of p32 and microtubules in alteration of mitochondrial functions by rubella virus.
21205079 2011 Mitochondrial p32/C1QBP is highly expressed in prostate cancer and is associated with shorter prostate-specific antigen relapse time after radical prostatectomy.
21156793 2011 The multicompartmental p32/gClqR as a new target for antibody-based tumor targeting strategies.
20950273 2011 Complement 1q-binding protein inhibits the mitochondrial permeability transition pore and protects against oxidative stress-induced death.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20810993 2010 An alternative role of C1q in cell migration and tissue remodeling: contribution to trophoblast invasion and placental development.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20100866 2010 Mitochondrial p32 protein is a critical regulator of tumor metabolism via maintenance of oxidative phosphorylation.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19828637 2009 Role of the receptor for the globular domain of C1q protein in the pathogenesis of hepatitis C virus-related cryoglobulin vascular damage.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19565630 2009 Increased expression of hyaluronic acid binding protein 1 is correlated with poor prognosis in patients with breast cancer.
19473882 2009 Frequency of gC1qR+CD4+ T cells increases during acute hepatitis C virus infection and remains elevated in patients with chronic infection.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19190731 2009 Persisting mixed cryoglobulinemia in Chikungunya infection.
19164550 2009 Inhibition of RIG-I and MDA5-dependent antiviral response by gC1qR at mitochondria.
19004836 2009 Evidence for inhibitory interaction of hyaluronan-binding protein 1 (HABP1/p32/gC1qR) with Streptococcus pneumoniae hyaluronidase.
18757437 2008 Mitochondrial/cell-surface protein p32/gC1qR as a molecular target in tumor cells and tumor stroma.
18676636 2008 Human p32 is a novel FOXC1-interacting protein that regulates FOXC1 transcriptional activity in ocular cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18538737 2008 Mitochondrial p32 is a critical mediator of ARF-induced apoptosis.
18460468 2008 Differential isoform expression and interaction with the P32 regulatory protein controls the subcellular localization of the splicing factor U2AF26.
18358546 2008 The multifunctional protein GC1q-R interacts specifically with the i3 loop arginine cluster of the vasopressin V2 receptor.
17907801 2007 Plasmodium falciparum uses gC1qR/HABP1/p32 as a receptor to bind to vascular endothelium and for platelet-mediated clumping.
17892212 2007 The exosporium of B. cereus contains a binding site for gC1qR/p33: implication in spore attachment and/or entry.
17881511 2007 HCV core protein interaction with gC1q receptor inhibits Th1 differentiation of CD4+ T cells via suppression of dendritic cell IL-12 production.
17693683 2007 Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction.
17486078 2007 The autophagic inducer smARF interacts with and is stabilized by the mitochondrial p32 protein.
16893067 2006 gC1qR/p33 serves as a molecular bridge between the complement and contact activation systems and is an important catalyst in inflammation.
16871385 2006 Protruding disordered loop of gC1qR is specifically exposed and related to antiapoptotic property in germ cell lineage.
16721827 2006 CDC2L5, a Cdk-like kinase with RS domain, interacts with the ASF/SF2-associated protein p32 and affects splicing in vivo.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16641292 2006 Cellular splicing and transcription regulatory protein p32 represses adenovirus major late transcription and causes hyperphosphorylation of RNA polymerase II.
16537587 2006 Acetylated Tat regulates human immunodeficiency virus type 1 splicing through its interaction with the splicing regulator p32.
16455055 2006 Evidence for the interaction of the regulatory protein Ki-1/57 with p53 and its interacting proteins.
16177118 2005 gC1q receptor ligation selectively down-regulates human IL-12 production through activation of the phosphoinositide 3-kinase pathway.
16164755 2005 Induction of p38- and gC1qR-dependent IL-8 expression in pulmonary fibroblasts by soluble hepatitis C core protein.
16140380 2006 Chemotaxis of human monocyte-derived dendritic cells to complement component C1q is mediated by the receptors gC1qR and cC1qR.
16039650 2005 HABP1/p32/gC1qR induces aberrant growth and morphology in Schizosaccharomyces pombe through its N-terminal alpha helix.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467913 2004 Tissue factor pathway inhibitor-2 (TFPI-2) recognizes the complement and kininogen binding protein gC1qR/p33 (gC1qR): implications for vascular inflammation.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15243141 2004 Human p32, interacts with B subunit of the CCAAT-binding factor, CBF/NF-Y, and inhibits CBF-mediated transcription activation in vitro.
15231747 2004 A protein interaction framework for human mRNA degradation.
15163734 2004 Direct binding of hepatitis C virus core to gC1qR on CD4+ and CD8+ T cells leads to impaired activation of Lck and Akt.
15031724 2004 Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14583623 2004 Human fibrillarin forms a sub-complex with splicing factor 2-associated p32, protein arginine methyltransferases, and tubulins alpha 3 and beta 1 that is independent of its association with preribosomal ribonucleoprotein complexes.
12833064 2003 Human p32 protein relieves a post-transcriptional block to HIV replication in murine cells.
12574814 2003 Activation-dependent surface expression of gC1qR/p33 on human blood platelets.
12538033 2003 Maturation-dependent expression of C1q binding proteins on the cell surface of human monocyte-derived dendritic cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12443542 2002 Evidence for the presence of HABP1 pseudogene in multiple locations of mammalian genome.
12220632 2002 The cytoplasmic tail peptide sequence of membrane type-1 matrix metalloproteinase (MT1-MMP) directly binds to gC1qR, a compartment-specific chaperone-like regulatory protein.
12034482 2002 The N-terminal conserved domain of rubella virus capsid interacts with the C-terminal region of cellular p32 and overexpression of p32 enhances the viral infectivity.
11866440 2002 Hyaluronan binding protein 1 (HABP1)/C1QBP/p32 is an endogenous substrate for MAP kinase and is translocated to the nucleus upon mitogenic stimulation.
11859136 2002 Cooperation of C1q receptors and integrins in C1q-mediated endothelial cell adhesion and spreading.
11773076 2002 The hemopexin-like C-terminal domain of membrane type 1 matrix metalloproteinase regulates proteolysis of a multifunctional protein, gC1qR.
11549288 2001 M phase-specific association of human topoisomerase IIIbeta with chromosomes.
11493647 2001 Retargeting of the mitochondrial protein p32/gC1Qr to a cytoplasmic compartment and the cell surface.
11350968 2001 Interaction between GABA(A) receptor beta subunits and the multifunctional protein gC1q-R.
11290596 2001 Expression and colocalization of cytokeratin 1 and urokinase plasminogen activator receptor on endothelial cells.
11278463 2001 The human gC1qR/p32 gene, C1qBP. Genomic organization and promoter analysis.
11086025 2000 Interaction between complement receptor gC1qR and hepatitis C virus core protein inhibits T-lymphocyte proliferation.
11083468 2000 Localization of P32 protein (gC1q-R) in mitochondria and at specific extramitochondrial locations in normal tissues.
10831594 2000 Protein kinase C [micro] is regulated by the multifunctional chaperon protein p32.
10823864 2000 Rubella virus capsid associates with host cell protein p32 and localizes to mitochondria.
10747014 2000 gC1q-R/p32, a C1q-binding protein, is a receptor for the InlB invasion protein of Listeria monocytogenes.
10722602 2000 Staphylococcus aureus protein A recognizes platelet gC1qR/p33: a novel mechanism for staphylococcal interactions with platelets.
10479529 1999 Cytokeratin 1 and gC1qR mediate high molecular weight kininogen binding to endothelial cells.
10097078 1999 Crystal structure of human p32, a doughnut-shaped acidic mitochondrial matrix protein.
10022843 1999 The splicing factor-associated protein, p32, regulates RNA splicing by inhibiting ASF/SF2 RNA binding and phosphorylation.
9721222 1998 Assignment of cDNA encoding hyaluronic acid-binding protein 1 to human chromosome 17p12-p13.
9461517 1998 C1q-mediated chemotaxis by human neutrophils: involvement of gClqR and G-protein signalling mechanisms.
9305894 1997 p32 protein, a splicing factor 2-associated protein, is localized in mitochondrial matrix and is functionally important in maintaining oxidative phosphorylation.
9284938 1997 Assignment of C1QBP encoding the C1q globular domain binding protein (gC1q-R) to human chromosome 17 band p13.3 by in situ hybridization.
9233640 1997 Evidence that the two C1q binding membrane proteins, gC1q-R and cC1q-R, associate to form a complex.
9191880 1997 The C1q-binding cell membrane proteins cC1q-R and gC1q-R are released from activated cells: subcellular distribution and immunochemical characterization.
8900153 1996 The binding protein for globular heads of complement C1q, gC1qR. Functional expression and characterization as a novel vitronectin binding factor.
8710908 1996 Identification of the zinc-dependent endothelial cell binding protein for high molecular weight kininogen and factor XII: identity with the receptor that binds to the globular "heads" of C1q (gC1q-R).
8662673 1996 Isolation and characterization of the kininogen-binding protein p33 from endothelial cells. Identity with the gC1q receptor.
8626563 1996 In vitro interaction between human immunodeficiency virus type 1 Rev protein and splicing factor ASF/SF2-associated protein, p32.
8567680 1996 Molecular cloning of human fibroblast hyaluronic acid-binding protein confirms its identity with P-32, a protein co-purified with splicing factor SF2. Hyaluronic acid-binding protein as P-32 protein, co-purified with splicing factor SF2.
8262387 1993 Cloning and expression of a cDNA covering the complete coding region of the P32 subunit of human pre-mRNA splicing factor SF2.
8195709 1994 Isolation, cDNA cloning, and overexpression of a 33-kD cell surface glycoprotein that binds to the globular "heads" of C1q.
8189522 1994 Cellular protein modulates effects of human immunodeficiency virus type 1 Rev.
7778269 1995 Identification of a novel human zinc finger protein that specifically interacts with the activation domain of lentiviral Tat proteins.
2372546 1990 NH2-terminal calcium-binding domain of human complement C1s- mediates the interaction of C1r- with C1q.
1830244 1991 Functional expression of cloned human splicing factor SF2: homology to RNA-binding proteins, U1 70K, and Drosophila splicing regulators.