Property Summary

NCBI Gene PubMed Count 19
PubMed Score 63.83
PubTator Score 29.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Primary ciliary dyskinesia 75 4.392 2.2
Botulism 20 3.276 1.6

Expression

Gene RIF (9)

PMID Text
23333304 HIV-1 Vif modulates the expression of C1D nuclear receptor corepressor (C1D) in Vif-expression T cells
20530579 C1D is associated with the DNA repair complex and may promote repair of ultraviolet irradiation-induced DNA damage.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
17599775 Anti-C1D autoantibodies were observed in patients with polymyositis-scleroderma overlap syndrome.
17412707 Results are consistent with a role for the exosome-associated protein C1D in the recruitment of the exosome to pre-rRNA to mediate the 3' end processing of the 5.8S rRNA.
11801738 TRAX enhances the DNA binding capacity of Translin, that binds to recombination regions in some malignancies. C1D interacts with TRAX following g-irradiation and prevents formation of TRAX/Translin complex, thereby inhibits any unwanted recombination.
9679063 The C1D protein interacts with the catalytic subunit of DNA-PK and is a very effective substrate for DNA-PK in vitro. Moreover, C1D directs the activation of DNA-PK in a manner that does not require DNA termini, suggesting a role for C1D in DNA repair.

AA Sequence

MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVY      1 - 70
LATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSK     71 - 140
S//

Text Mined References (23)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25416956 2014 A proteome-scale map of the human interactome network.
20530579 2010 XPB induces C1D expression to counteract UV-induced apoptosis.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17599775 2007 C1D is a major autoantibody target in patients with the polymyositis-scleroderma overlap syndrome.
17412707 2007 C1D and hMtr4p associate with the human exosome subunit PM/Scl-100 and are involved in pre-rRNA processing.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12379155 2002 Proteasome-mediated degradation antagonizes critical levels of the apoptosis-inducing C1D protein.
11801738 2002 DNA damage-dependent interaction of the nuclear matrix protein C1D with Translin-associated factor X (TRAX).
11311939 2001 Promoter of the gene encoding the 16 kDa DNA-binding and apoptosis-inducing C1D protein.
10362552 1999 Induction of apoptosis by overexpression of the DNA-binding and DNA-PK-activating protein C1D.
9852280 1998 Identification of a novel Rac3-interacting protein C1D.
9679063 1998 DNA end-independent activation of DNA-PK mediated via association with the DNA-binding protein C1D.
9469821 1998 cDNA cloning, recombinant expression and characterization of polypetides with exceptional DNA affinity.
9405624 1997 Cloning and characterization of a corepressor and potential component of the nuclear hormone receptor repression complex.