Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
facioscapulohumeral dystrophy 286 1.4e-03

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 2.100 1.4e-03

AA Sequence

MQPEVEPVCFPAMGSPTMHRKAGALLMDLETPEEMQARSLGRPIKSSKQYLRQVIAEYEALDRELPCIRK      1 - 70
FPTPPASQPLCLCMETLPEEDFTHLEVLQALEAQLPGAMESGRVSSIRFENMNVICGTAGRRNRWLIAVT     71 - 140
DFQTRSRLLRSGLSPRGLAHQIVRHDDLLLGDYRLHLRRSLVRRRMLEALGAEPNEEA                141 - 198
//

Text Mined References (1)

PMID Year Title
15057824 2004 The DNA sequence and biology of human chromosome 19.