Putative uncharacterized protein C19orf73

Property Summary

NCBI Gene PubMed Count	4
PubMed Score	0.00

Knowledge Summary

Patent

No data available

Expression

Specificity
Differential

Brain - Cerebellar Hemisphere 18,015

Brain - Cerebellum 17,983

Pituitary 18,147

Brain - Frontal Cortex (BA9) 18,069

Brain - Spinal cord (cervical c-1) 17,973

Brain - Cortex 18,039

Brain - Nucleus accumbens (basal ganglia... 18,024

Thyroid 18,024

Brain - Hypothalamus 18,169

Brain - Anterior cingulate cortex (BA24) 17,989

Skin - Not Sun Exposed (Suprapubic) 18,081

Minor Salivary Gland 18,005

Brain - Caudate (basal ganglia) 18,001

Skin - Sun Exposed (Lower leg) 17,968

Spleen 17,614

Brain - Amygdala 18,006

Brain - Putamen (basal ganglia) 17,863

Brain - Hippocampus 18,011

Brain - Substantia nigra 17,981

Esophagus - Mucosa 18,076

Testis 18,518

Adrenal Gland 18,071

Breast - Mammary Tissue 18,103

Prostate 18,213

Artery - Coronary 17,949

Liver 18,071

Pancreas 18,123

Small Intestine - Terminal Ileum 17,954

Colon - Transverse 17,825

Vagina 17,834

Adipose - Visceral (Omentum) 17,937

Artery - Aorta 17,896

Colon - Sigmoid 18,089

Adipose - Subcutaneous 18,110

Esophagus - Muscularis 18,017

Cells - Transformed fibroblasts 17,577

Heart - Atrial Appendage 17,896

Uterus 17,618

Kidney - Cortex 17,329

Nerve - Tibial 18,007

Esophagus - Gastroesophageal Junction 18,000

Cells - EBV-transformed lymphocytes 18,186

Artery - Tibial 17,631

Stomach 17,879

Muscle - Skeletal 17,778

Heart - Left Ventricle 18,006

Lung 18,057

Whole Blood 17,439

Ovary 17,971

Adult Frontal Cortex 9,048

Adult Retina 10,115

Adult Spinal Cord 7,594

adipose tissue 15,837

adrenal gland 15,963

appendix 16,247

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

colon 15,959

duodenum 15,975

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

lung 16,312

lymph node 15,833

pancreas 14,070

parathyroid gland 14,769

placenta 15,937

prostate 16,460

rectum 15,705

salivary gland 14,981

seminal vesicle 15,918

skeletal muscle 14,011

skin 16,206

small intestine 16,154

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

Synonym

Accession	Q9NVV2 Q6NSX4
Symbols

Gene

C19orf73

Ortholog (1)

Species	Source	Disease
Chimp	OMA EggNOG

UniProt Keyword (3)

Complete proteome 20,231

Polymorphism 12,194

Reference proteome 20,231

Compartment GO Term (3)

Cytosol 6,686

Nucleus 7,563

cellular_component 18,320

HCA RNA Cell Line (55)

A-431 16,131

A549 15,174

AF22 16,160

AN3-CA 15,648

ASC TERT1 14,842

BEWO 16,726

BJ 15,448

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

See all...

AA Sequence

MRLKVGFQGGGCFRKDALCLEGGVSARWARAPHSAPLRPPRELHAAPPPATPTQTVVRPAGFPRRTRLMV      1 - 70
RSAPPTQRPPTGSGCVSGLWRKGLGLRPQTLLRVGSVVLSSAPALRPRLGPCLRPPPSD                71 - 129
//

Text Mined References (6)

Summary
Details

	PMID	Year	Title