Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.14
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 6.3e-06
Multiple myeloma 1332 1.1e-03
non primary Sjogren syndrome sicca 891 4.0e-02

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.570 1.1e-03
non primary Sjogren syndrome sicca 1.100 4.0e-02
ovarian cancer 2.100 6.3e-06

Synonym

Accession Q9UNZ5 B2R4J9
Symbols LYDG10
HSPC023

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAQGQRKFQAHKPAKSKTAAAASEKNRGPRKGGRVIAPKKARVVQQQKLKKNLEVGIRKKIEHDVVMKAS      1 - 70
SSLPKKLALLKAPAKKKGAAAATSSKTPS                                              71 - 99
//

Text Mined References (9)

PMID Year Title