Property Summary

NCBI Gene PubMed Count 13
PubMed Score 13.12
PubTator Score 6.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9GZP8 Q0P6G2 Q96H58 Q9HCR4
Symbols IMUP
H2RSP
IMUP-1
IMUP-2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

AA Sequence

MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKQGHHSSSDSSSSSSDSDTDVKSHA      1 - 70
AGSKQHESIPGKAKKPKVKKKEKGKKEKGKKKEAPH                                       71 - 106
//

Text Mined References (15)

PMID Year Title