Property Summary

NCBI Gene PubMed Count 6
PubMed Score 10.66
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -1.057 2.0e-02
glioblastoma 1.500 2.0e-09
sonic hedgehog group medulloblastoma 2.200 4.4e-08
atypical teratoid / rhabdoid tumor 1.400 8.0e-07
medulloblastoma, large-cell 1.200 1.2e-02
primitive neuroectodermal tumor 2.200 5.0e-05
adrenocortical carcinoma 1.145 4.8e-03
sarcoidosis 1.200 4.8e-03
Breast cancer 2.100 2.8e-02
pediatric high grade glioma 1.600 2.8e-07
pilocytic astrocytoma 1.200 1.1e-05

AA Sequence

MAKSKTKHRLCSQESSVSALLASCTLSGSNSSNSDGSFHYKDKLYRSASQALQAYIDDFDLGQIYPGAST      1 - 70
GKINIDEDFTNMSQFCNYIYKPNNAFENLDHKKHSNFISCRRHTVNDIDSMSLTTDDLLRLPADGSFSYT     71 - 140
YVGPSHRTSKKNKKCRGRLGSLDIEKNPHFQGPYTSMGKDNFVTPVIRSNINGKQCGDKIELLILKAKRN    141 - 210
LEQCTEELPKSMKKDDSPCSLDKLEADRSWENIPVTFKSPVPVNSDDSPQQTSRAKSAKGVLEDFLNNDN    211 - 280
QSCTLSGGKHHGPVEALKQMLFNLQAVQERFNQNKTTDPKEEIKQVSEDDFSKLQLKESMIPITRSLQKA    281 - 350
LHHLSRLRDLVDDTNGERSPKM                                                    351 - 372
//

Text Mined References (8)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.