Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.49
PubTator Score 2.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus 1.300 3.3e-03
ependymoma 1.200 2.1e-02
esophageal adenocarcinoma -1.400 1.9e-02
group 4 medulloblastoma 1.100 6.3e-03
osteosarcoma -1.723 9.6e-08
ovarian cancer 1.300 1.7e-07
pituitary cancer 1.100 5.2e-05
spina bifida -1.215 4.0e-02

Gene RIF (2)

AA Sequence

MKMEEAVGKVEELIESEAPPKASEQETAKEEDGSVELESQVQKDGVADSTVISSMPCLLMELRRDSSESQ      1 - 70
LASTESDKPTTGRVYESDSSNHCMLSPSSSGHLADSDTLSSAEENEPSQAETAVEGDPSGVSGATVGRKS     71 - 140
RRSRSESETSTMAAKKNRQSSDKQNGRVAKVKGHRSQKHKERIRLLRQKREAAARKKYNLLQDSSTSDSD    141 - 210
LTCDSSTSSSDDDEEVSGSSKTITAEIPDGPPVVAHYDMSDTNSDPEVVNVDNLLAAAVVQEHSNSVGGQ    211 - 280
DTGATWRTSGLLEELNAEAGHLDPGFLASDKTSGNAPLNEEINIASSDSEVEIVGVQEHARCVHPRGGVI    281 - 350
QSVSSWKHGSGTQYVSTRQTQSWTAVTPQQTWASPAEVVDLTLDEDSRRKYLL                     351 - 403
//

Text Mined References (21)

PMID Year Title