Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.33
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -1.200 1.3e-02
osteosarcoma -1.139 2.3e-03

Gene RIF (1)

AA Sequence

MRQKHYLEAAARGLHDSCPGQARYLLWAYTSSHDDKSTFEETCPYCFQLLVLDNSRVRLKPKARLTPKIQ      1 - 70
KLLNREARNYTLSFKEAKMVKKFKDSKSVLLITCKTCNRTVKHHGKSRSFVSTLKSNPATPTSKLSLKTP     71 - 140
ERRTANPNHDMSGSKGKSPASVFRTPTSGQSVSTCSSKNTSKTKKHFSQLKMLLSQNESQKIPKVDFRNF    141 - 210
LSSLKGGLLK                                                                211 - 220
//

Text Mined References (6)

PMID Year Title