Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.33
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.139 2.3e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.3e-02

Synonym

Accession Q32NC0 Q6GW03 Q9BXV6 Q9BXW2
Symbols XTP13
HsT3108
PNAS-124
PNAS-131

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
22082156 Knockdown of chromosome 18 open reading frame 21 (C18orf21) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N

AA Sequence

MRQKHYLEAAARGLHDSCPGQARYLLWAYTSSHDDKSTFEETCPYCFQLLVLDNSRVRLKPKARLTPKIQ      1 - 70
KLLNREARNYTLSFKEAKMVKKFKDSKSVLLITCKTCNRTVKHHGKSRSFVSTLKSNPATPTSKLSLKTP     71 - 140
ERRTANPNHDMSGSKGKSPASVFRTPTSGQSVSTCSSKNTSKTKKHFSQLKMLLSQNESQKIPKVDFRNF    141 - 210
LSSLKGGLLK                                                                211 - 220
//

Text Mined References (6)

PMID Year Title
24223155 2013 Genome wide analysis of drug-induced torsades de pointes: lack of common variants with large effect sizes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.