Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 4.5e-04

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.043 4.5e-04

 Compartment GO Term (0)

AA Sequence

MQGQGALKESHIHLPTEQPEASLVLQGQLAESSALGPKGALRPQAQSPDVPVSWWQGSGKRLSHRLPHIC      1 - 70
SQPPLGPFLPLTWPSCGFFGLGGAASASLGLEVLQDSVSTWARGPCCPVHPQSLTVVCMCACMCVCVHVC     71 - 140
ACVYVCMCVLVCMCACACMRAHRYFLMDCAGICSPHGPGTQ                                 141 - 181
//

Text Mined References (1)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.