Property Summary

NCBI Gene PubMed Count 2
PubMed Score 3.45
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ependymoma 4679 5.2e-09
interstitial cystitis 2312 8.8e-03
active ulcerative colitis 764 2.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Bilirubin metabolic disorder 41 3.113 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
active ulcerative colitis -1.111 2.9e-02
ependymoma 1.700 5.2e-09
interstitial cystitis -1.500 8.8e-03

Synonym

Accession Q6ZQX7 A5D8T6 Q6NSI2 Q6PFW9
Symbols CK20
LIAT1

Gene

  Ortholog (1)

Species Source Disease
Inparanoid OMA

 GO Process (1)

AA Sequence

METRGPGLAVRAESRRLVGIGPRAPPGRVGLQPSGRLDRRGGAGTMGYKDNDGEEEEREGGAAGPRGSRL      1 - 70
PPITGGASELAKRKVKKKKRKKKTKGSGKGDDKHQSQSLKSQPLSSSFHDILSPCKERGPKPEHRQSKVE     71 - 140
KKHLPSDSSTVSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCLALKGFHPDPE    141 - 210
ALKGFHPDPDALKGFHPDPEALKGFHPDPEALKGFHPDPEALKGFHPDPEALKGIHPDPEALKGIHPDPE    211 - 280
ALKGFHPDPEALKGFHPDPEALKGFHTDPEALKGFHIDPEALKGFHPDPKALKGFHPDPKALKGFHTDPE    281 - 350
ALKGFHPDPKALKGFHPDPEALKGFHPDPEALKGFHPDPEALKGFHTDPNAEEAPENLPYLSDKDGSSSH    351 - 420
RQPTSKAECPNLCFEGNLTPKLLHSDLAPTLLE                                         421 - 453
//

Text Mined References (5)

PMID Year Title