Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.92
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 7.9e-03
psoriasis 1.100 1.1e-03
glioblastoma 1.500 7.6e-03
osteosarcoma -1.525 5.6e-04
astrocytoma 1.600 3.1e-03
interstitial cystitis 1.300 2.6e-04
adult high grade glioma 1.200 1.4e-04
pilocytic astrocytoma 1.200 6.8e-09
progressive supranuclear palsy -1.100 1.8e-02
Breast cancer 1.200 1.4e-14
gastric carcinoma 1.200 1.3e-02
ovarian cancer 2.200 1.4e-06

AA Sequence

MYLQVETRTSSRLHLKRAPGIRSWSLLVGILSIGLAAAYYSGDSLGWKLFYVTGCLFVAVQNLEDWEEAI      1 - 70
FDKSTGKVVLKTFSLYKKLLTLFRAGHDQVVVLLHDVRDVSVEEEKVRYFGKGYMVVLRLATGFSHPLTQ     71 - 140
SAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS                           141 - 187
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25279986 2014 Genome-wide association study identifies five susceptibility loci for follicular lymphoma outside the HLA region.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21503106 2011 [Study on the mechanism of C17orf62 induced cell death].
21269460 2011 Initial characterization of the human central proteome.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12878157 2003 Redifferentiation of dedifferentiated chondrocytes and chondrogenesis of human bone marrow stromal cells via chondrosphere formation with expression profiling by large-scale cDNA analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.