Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.94
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.200 1.4e-04
astrocytoma 1.600 3.1e-03
Astrocytoma, Pilocytic 1.200 7.4e-09
Breast cancer 1.200 1.4e-14
cutaneous lupus erythematosus 1.200 7.9e-03
gastric carcinoma 1.200 1.3e-02
glioblastoma 1.100 1.5e-08
interstitial cystitis 1.300 2.6e-04
osteosarcoma -1.525 5.6e-04
ovarian cancer 2.200 1.4e-06
progressive supranuclear palsy -1.100 1.8e-02
psoriasis 1.100 1.1e-03

AA Sequence

MYLQVETRTSSRLHLKRAPGIRSWSLLVGILSIGLAAAYYSGDSLGWKLFYVTGCLFVAVQNLEDWEEAI      1 - 70
FDKSTGKVVLKTFSLYKKLLTLFRAGHDQVVVLLHDVRDVSVEEEKVRYFGKGYMVVLRLATGFSHPLTQ     71 - 140
SAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS                           141 - 187
//

Text Mined References (18)

PMID Year Title