Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

 Compartment GO Term (0)

AA Sequence

MNNSLDYLAYPVIVSNHRQSTTFRKKLDFGHYVSHKNRIQIAKPTVDTKPPVAHTNHILKLSKLQGEQKK      1 - 70
INKIEYENKQLCQKIANAHRGPAKVDCWNEYFSKSLNRETRNRELVRITMENQGILKRLVDRKPHYDRRA     71 - 140
SEIDWQNSRRYIRNTTRYLLSQNE                                                  141 - 164
//

Text Mined References (2)

PMID Year Title