Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 547.17

Knowledge Summary

Patent

No data available

Synonym

Accession Q7Z2V1 B9EGC2 Q8NEF0
Symbols TNT

Gene

  Ortholog (3)

 Compartment GO Term (0)

AA Sequence

MSLVPGQHCSPSHTRLHLTSPITMGTEPATQNTEFSKGSLIYGVTSPQRGHSQHSEASQGPLSLDKPLQL      1 - 70
PPIFLEGEKGESSVQNEQEGEPSLQSPSLELQSPAWPRHAGVAQEPLKVSSSYLSDTQSSESHVSSVQHP     71 - 140
RPEEGSHASLSSGYAGDKEGSDISLVGSHRRVRLNRRLNTQAASNQTSQLGSIDPPSSLKSRLTGPAHST    141 - 210
KQTGGKE                                                                   211 - 217
//

Text Mined References (3)

PMID Year Title