Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 547.17

Knowledge Summary

Patent

No data available

Synonym

Accession Q7Z2V1 B9EGC2 Q8NEF0
Symbols TNT

Gene

  Ortholog (1)

Species Source Disease
Rat OMA Inparanoid

 Compartment GO Term (0)

AA Sequence

MSLVPGQHCSPSHTRLHLTSPITMGTEPATQNTEFSKGSLIYGVTSPQRGHSQHSEASQGPLSLDKPLQL      1 - 70
PPIFLEGEKGESSVQNEQEGEPSLQSPSLELQSPAWPRHAGVAQEPLKVSSSYLSDTQSSESHVSSVQHP     71 - 140
RPEEGSHASLSSGYAGDKEGSDISLVGSHRRVRLNRRLNTQAASNQTSQLGSIDPPSSLKSRLTGPAHST    141 - 210
KQTGGKE                                                                   211 - 217
//

Text Mined References (3)

PMID Year Title