Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.32
PubTator Score 0.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma 1.568 1.3e-03
medulloblastoma, large-cell -1.500 1.6e-05
primary pancreatic ductal adenocarcinoma 1.105 1.1e-02
tuberculosis -1.200 2.4e-06
adult high grade glioma -1.400 1.2e-04
group 4 medulloblastoma 1.200 2.2e-03
aldosterone-producing adenoma -1.238 4.9e-02
invasive ductal carcinoma -1.256 2.7e-02
spina bifida -1.645 3.7e-02
ovarian cancer 1.700 1.3e-05
pancreatic cancer 1.100 9.7e-03

AA Sequence

MEERKEEGEAEIQEHGPEHWFSKWERQCLAEAEQDEQLPPELQEEAAAAAQPEHKQQKLWHLFQNSATAV      1 - 70
AQLYKDRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGYQRRNKDVLAWVKKRRRTIRR     71 - 140
EDLISFLCGKVPPPRNSRAPPRLTVVSPNRATSTETSSSVETDLQPFREAIALHGLSGAMASISVRSSTP    141 - 210
GSPTHVSSGSNASRRRNGLHDVDLNTFISEEMALHLDNGGTRKRTSAQCGDVITDSPTHKRNRMI         211 - 275
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23942779 2013 A genome-wide association study of behavioral disinhibition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.