Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
spina bifida 1074 3.8e-02


  Differential Expression (1)

Disease log2 FC p
spina bifida -1.279 3.8e-02

Gene RIF (2)

AA Sequence

DLSDPFLSFKVDLGISLLEEVLQMLREQFPSEPSF                                       141 - 175

Text Mined References (7)

PMID Year Title