Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.200 1.8e-02
ependymoma -1.600 3.4e-09
atypical teratoid / rhabdoid tumor -1.600 8.6e-05
glioblastoma -1.500 1.3e-06
medulloblastoma -1.400 9.4e-04
intraductal papillary-mucinous adenoma (... -1.100 3.0e-04
adult high grade glioma -1.300 6.4e-04
pilocytic astrocytoma -1.200 5.2e-05
non primary Sjogren syndrome sicca 1.400 1.5e-02
subependymal giant cell astrocytoma -1.316 1.9e-02
ovarian cancer 1.800 9.2e-04

AA Sequence

MEALRRAHEVALRLLLCRPWASRAAARPKPSASEVLTRHLLQRRLPHWTSFCVPYSAVRNDQFGLSHFNW      1 - 70
PVQGANYHVLRTGCFPFIKYHCSKAPWQDLARQNRFFTALKVVNLGIPTLLYGLGSWLFARVTETVHTSY     71 - 140
GPITVYFLNKEDEGAMY                                                         141 - 157
//

Text Mined References (3)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.