Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.60
PubTator Score 6.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma 1.500 9.5e-07
non-small cell lung carcinoma 1.500 4.3e-18
psoriasis 1.400 4.6e-44

Gene RIF (2)

AA Sequence

MSFFQLLMKRKELIPLVVFMTVAAGGASSFAVYSLWKTDVILDRKKNPEPWETVDPTVPQKLITINQQWK      1 - 70
PIEELQNVQRVTK                                                              71 - 83
//

Text Mined References (7)

PMID Year Title