Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 2.0e-05
hepatocellular carcinoma 547 8.3e-05
osteosarcoma 7950 3.1e-03
tuberculosis 2010 1.2e-02
acute myeloid leukemia 783 2.5e-02

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia -1.800 2.5e-02
hepatocellular carcinoma 1.300 8.3e-05
osteosarcoma -1.051 3.1e-03
ovarian cancer 1.900 2.0e-05
tuberculosis -1.100 1.2e-02

AA Sequence

MPLESSSSMPLSFPSLLPSVPHNTNPSPPLMSYITSQEMKCILHWFANWSGPQRERFLEDLVAKAVPEKL      1 - 70
QPLLDSLEQLSVSGADRPPSIFECQLHLWDQWFRGWAEQERNEFVRQLEFSEPDFVAKFYQAVAATAGKD     71 - 140
//

Text Mined References (7)

PMID Year Title