Property Summary

NCBI Gene PubMed Count 20
PubMed Score 12.61
PubTator Score 5.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
esophageal adenocarcinoma -1.100 2.5e-02
osteosarcoma 1.523 1.6e-03
atypical teratoid / rhabdoid tumor 1.200 4.9e-04
pancreatic ductal adenocarcinoma liver m... -1.417 4.6e-03
lung cancer -1.400 2.4e-03
sarcoidosis -1.200 1.4e-02
posterior fossa group B ependymoma 1.100 1.3e-07
ovarian cancer 1.800 4.5e-05
pituitary cancer 1.100 4.3e-06

 GO Function (1)

Gene RIF (1)

PMID Text
21934552 Data indicate that integrin beta6, CD46, tissue factor, and chromosome 14 open reading frame 1 (C14ORF1), were identified as overexpressed on pancreatic cancer cell lines.

AA Sequence

MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQARTFGIWTLLSSVIRCLCAID      1 - 70
IHNKTLYHITLWTFLLALGHFLSELFVYGTAAPTIGVLAPLMVASFSILGMLVGLRYLEVEPVSRQKKRN     71 - 140
//

Text Mined References (22)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24326590 2013 Arabidopsis ERG28 tethers the sterol C4-demethylation complex to prevent accumulation of a biosynthetic intermediate that interferes with polar auxin transport.
23142642 2013 Identifying protein partners of CLN8, an ER-resident protein involved in neuronal ceroid lipofuscinosis.
21934552 2012 RNA interference characterization of proteins discovered by proteomic analysis of pancreatic cancer reveals function in cell growth and survival.
21269460 2011 Initial characterization of the human central proteome.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12958361 2003 Nuclear membrane proteins with potential disease links found by subtractive proteomics.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11910120 2001 Accelerated molecular evolution of insect orthologues of ERG28/C14orf1: a link with ecdysteroid metabolism?
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11160377 2001 A novel gene conserved from yeast to humans is involved in sterol biosynthesis.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10967139 2000 The genomic structure of c14orf1 is conserved across eukarya.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10449901 1999 A novel human gene, encoding a potential membrane protein conserved from yeast to man, is strongly expressed in testis and cancer cell lines.