Property Summary

NCBI Gene PubMed Count 7
PubMed Score 36.29
PubTator Score 23.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
oligodendroglioma -1.800 4.1e-02
osteosarcoma 2.346 2.8e-04
chronic lymphosyte leukemia -2.000 7.5e-13
fascioscapulohumeral muscular dystrophy 1.491 2.2e-04
adrenocortical carcinoma 1.377 5.0e-02
non-small cell lung cancer 1.118 2.8e-05
intraductal papillary-mucinous neoplasm ... 1.400 3.0e-02
active ulcerative colitis 1.195 3.0e-02
interstitial cystitis 1.400 5.0e-03
group 3 medulloblastoma 1.400 1.9e-02
primary Sjogren syndrome 1.300 1.4e-03
psoriasis 1.300 1.9e-61
ovarian cancer 1.500 2.4e-02
pituitary cancer 2.300 4.4e-05

AA Sequence

MGCGNSTATSAGAGQGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRKN             1 - 63
//

Text Mined References (9)

PMID Year Title
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
23419831 2014 APOE and BCHE as modulators of cerebral amyloid deposition: a florbetapir PET genome-wide association study.
22935015 2013 A novel transcript is up-regulated by fasting in the hypothalamus and enhances insulin signalling.
19531736 2009 Transcripts of unknown function in multiple-signaling pathways involved in human stem cell differentiation.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11890990 2002 Cloning of the mRNA of overexpression in colon carcinoma-1: a sequence overexpressed in a subset of colon carcinomas.