Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer 2.900 2.6e-02
group 4 medulloblastoma -1.400 1.7e-02
interstitial cystitis -1.300 8.2e-05
invasive ductal carcinoma 1.400 1.2e-02
medulloblastoma, large-cell 1.100 6.5e-04
non-small cell lung cancer 1.326 1.1e-16
osteosarcoma -1.709 6.5e-04
pancreatic ductal adenocarcinoma liver m... -1.100 4.8e-03
Rheumatoid arthritis 1.600 3.7e-02

Gene RIF (1)

AA Sequence

MGESIPLAAPVPVEQAVLETFFSHLGIFSYDKAKDNVEKEREANKSAGGSWLSLLAALAHLAAAEKVYHS      1 - 70
LTYLGQKLGGQSFFSRKDSIRTIYTSLHNELKKVVTGRGALGGTAPHVEELLSHLSEQLCFFVQARMEMA     71 - 140
DFYEKMYTLSTQKFINAEELVGLLDAIMKKYSSRFHHPILSPLESSFQLEVDVLCHLLKAQAQVSEWKFL    141 - 210
PSLVNLHSAHTKLQTWGQIFEKQRETKKHLFGGQSQKAVQPPHLFLWLMKLKNMLLAKFSFYFHEALSRQ    211 - 280
TTASEMKTLTAKANPDFFGKISSFIRKYDAANVSLIFDNRGSESFQGHGYHHPHSYREAPKGVDQYPAVV    281 - 350
SLPSDRPVMHWPNVIMIMTDRTSDLNSLEKVVHFYDDKVQSTYFLTRPEPHFTIVIIFESKKSERDSHFI    351 - 420
SFLNEVSLALKNPKVFASLKPGAKG                                                 421 - 445
//

Text Mined References (7)

PMID Year Title