Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.04
PubTator Score 0.05

Knowledge Summary


No data available



  Differential Expression (6)

Disease log2 FC p
adrenocortical carcinoma -1.919 9.7e-07
atypical teratoid / rhabdoid tumor 1.200 2.7e-05
group 3 medulloblastoma 1.500 5.1e-04
lung carcinoma 1.200 9.0e-18
medulloblastoma, large-cell 1.500 2.7e-04
primitive neuroectodermal tumor 1.200 4.7e-04

AA Sequence

LEQIVKAMGPILEILQKAIKTMEMNISVFKKASDK                                       211 - 245

Text Mined References (4)

PMID Year Title