Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.04
PubTator Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
group 4 medulloblastoma 2.000 7.7e-05
atypical teratoid / rhabdoid tumor 1.200 2.7e-05
medulloblastoma, large-cell 1.500 2.7e-04
primitive neuroectodermal tumor 1.200 4.7e-04
adrenocortical carcinoma -1.919 9.7e-07
lung carcinoma 1.200 9.0e-18

AA Sequence

MSSESEKDKERLIQAAKMFFFHVQDLASVINTLTELFSRSMNTQILLMAVKNNSYIKDFFEQMLKIFKEM      1 - 70
QSVVDARHDKIQKESLCSKVAMAMCSVVQKSTNVEELHQSAKEVFKSAHTPVIISVLNSSNILGSLESSL     71 - 140
SHLMKFPIMNLQLSDFYTEDTKEQSDVTTSERTRSPPGSSKTTMIDTLKKLQDVLKTEDSKNPTKSAADL    141 - 210
LEQIVKAMGPILEILQKAIKTMEMNISVFKKASDK                                       211 - 245
//

Text Mined References (4)

PMID Year Title
23449627 2013 Genome-wide association and longitudinal analyses reveal genetic loci linking pubertal height growth, pubertal timing and childhood adiposity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.