Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.10
PubTator Score 1.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Pick disease 1894 2.5e-05
atypical teratoid / rhabdoid tumor 5112 8.4e-05
medulloblastoma, large-cell 6241 1.7e-04
ovarian cancer 8520 4.7e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Distal arthrogryposis 42 4.093 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 8.4e-05
medulloblastoma, large-cell -1.100 1.7e-04
ovarian cancer 1.200 4.7e-04
Pick disease -1.100 2.5e-05

Gene RIF (2)

AA Sequence

MKKNRERFCNREREFVYKFKVGSQCLELRVPLKFPVQENASHLHGRLMLLHSLPCFIEKDLKEALTQFIE      1 - 70
EESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPSWDEDFADVYHDLIHSPASET     71 - 140
LLNLEHNYFVSISELIGERDVELKKLRERQGIEMEKVMQELGKSLTDQDVNSLAAQHFESQQDLENKWSN    141 - 210
ELKQSTAIQKQEYQEWVIKLHQDLKNPNNSSLSEEIKVQPSQFRESVEAIGRIYEEQRKLEESFTIHLGA    211 - 280
QLKTMHNLRLLRADMLDFCKHKRNHRSGVKLHRLQTALSLYSTSLCGLVLLVDNRINSYSGIKRDFATVC    281 - 350
QECTDFHFPRIEEQLEVVQQVVLYARTQRRSKLKESLDSGNQNGGNDDKTKNAERNYLNVLPGEFYITRH    351 - 420
SNLSEIHVAFHLCVDDHVKSGNITARDPAIMGLRNILKVCCTHDITTISIPLLLVHDMSEEMTIPWCLRR    421 - 490
AELVFKCVKGFMMEMASWDGGISRTVQFLVPQSISEEMFYQLSNMLPQIFRVSSTLTLTSKH            491 - 552
//

Text Mined References (7)

PMID Year Title